BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= S06A01NCLL0001_O20 (540 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_15432| Best HMM Match : Ribosomal_L10 (HMM E-Value=3.1e-37) 171 4e-43 SB_8680| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.4 SB_4107| Best HMM Match : M (HMM E-Value=8e-22) 28 4.2 SB_9039| Best HMM Match : M (HMM E-Value=0.00046) 28 4.2 SB_17157| Best HMM Match : Kinesin (HMM E-Value=0.59) 27 7.4 SB_23990| Best HMM Match : DUF1677 (HMM E-Value=1.7) 27 7.4 >SB_15432| Best HMM Match : Ribosomal_L10 (HMM E-Value=3.1e-37) Length = 261 Score = 171 bits (415), Expect = 4e-43 Identities = 78/110 (70%), Positives = 94/110 (85%) Frame = +2 Query: 11 MMRKAIKDHLETNPALEKLLPHIKGNVGFVFTRGDLVDVRDKLLENKVQAPARPGAIAPL 190 M+RKAI+ HLE NP LEKLLPHIKGN+GFVFT+ DL DVR ++ENKV APA+ G IAP+ Sbjct: 42 MIRKAIRGHLENNPDLEKLLPHIKGNIGFVFTKEDLADVRKIIMENKVAAPAKAGVIAPI 101 Query: 191 SVVIPAHNTGLGPEKTSFFQALSIPTKISKGTIEIINDVHILKPGDKVGA 340 V +PA NTGLGPEKTSFFQAL+IPTKI++GTIEIINDVH++K +K+ A Sbjct: 102 DVFVPAGNTGLGPEKTSFFQALAIPTKIARGTIEIINDVHLIKKDEKLKA 151 >SB_8680| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 2462 Score = 29.9 bits (64), Expect = 1.4 Identities = 18/65 (27%), Positives = 28/65 (43%), Gaps = 2/65 (3%) Frame = +2 Query: 143 ENKVQAPARPGAIAPLSVVIPAHN--TGLGPEKTSFFQALSIPTKISKGTIEIINDVHIL 316 E ++ +PA +P S+ TGL P S Q LS+ T + ++ D+ Sbjct: 2069 EPRIVSPAGSSLASPTSIATSVITGVTGLHPVTVSHHQPLSVITSLVSASVSSTTDMQNS 2128 Query: 317 KPGDK 331 PG K Sbjct: 2129 TPGKK 2133 >SB_4107| Best HMM Match : M (HMM E-Value=8e-22) Length = 2039 Score = 28.3 bits (60), Expect = 4.2 Identities = 14/37 (37%), Positives = 23/37 (62%), Gaps = 2/37 (5%) Frame = -1 Query: 531 RRVPDGQRERGHVGHSSKELLAKVLRLDVE--NCRRE 427 R++ D +RE+ V H++ EL KV + + E N RR+ Sbjct: 1120 RQLKDEEREKDAVSHTANELRGKVKKSEAEKTNLRRQ 1156 >SB_9039| Best HMM Match : M (HMM E-Value=0.00046) Length = 716 Score = 28.3 bits (60), Expect = 4.2 Identities = 27/100 (27%), Positives = 42/100 (42%), Gaps = 2/100 (2%) Frame = -3 Query: 487 LQQGTSREGPPA*CRELPARRWYRSRTPV*QQDHTKRERCSHVEKSSFRSSHLITRLQDM 308 L + T+ E E R+ RSR + Q + K+E V+K S L + DM Sbjct: 567 LSENTAEEATAGSNLEEIQRKINRSREEMQQIERRKKELQEEVDKLSGLRDRLSHDIADM 626 Query: 307 -DIIDNFNSTL*NLSGDGKSLEER-SLLRTKASVMSGNDD 194 D + + +L+E+ LLR K M+ N+D Sbjct: 627 RSRYDQMQRSYRQQEQEFNALQEKQELLRRKLDQMNANED 666 >SB_17157| Best HMM Match : Kinesin (HMM E-Value=0.59) Length = 2053 Score = 27.5 bits (58), Expect = 7.4 Identities = 14/39 (35%), Positives = 21/39 (53%) Frame = -1 Query: 336 PTLSPGFRIWTSLIISIVPFEILVGMERAWKKEVFSGPR 220 P P FR +L+ ++ ++ M RAW+KEV S R Sbjct: 1843 PRNVPNFRACCALVSALSGYQY---MRRAWRKEVISSQR 1878 >SB_23990| Best HMM Match : DUF1677 (HMM E-Value=1.7) Length = 493 Score = 27.5 bits (58), Expect = 7.4 Identities = 18/61 (29%), Positives = 31/61 (50%), Gaps = 3/61 (4%) Frame = -1 Query: 513 QRERGHVGHSSKELLAKVLRLDVENCRREDGTGVVHLFDNKTI---RKGRDVHMLRRVAS 343 Q + G +G S KE +AK + + ++ G+ NK + +KG+ +H +RRV Sbjct: 278 QPKLGDIGKSKKEHIAKDDKQQIYRNIQKLYRGMSSKTHNKNLDGTKKGKHIHEIRRVRR 337 Query: 342 E 340 E Sbjct: 338 E 338 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 18,234,106 Number of Sequences: 59808 Number of extensions: 397031 Number of successful extensions: 1154 Number of sequences better than 10.0: 6 Number of HSP's better than 10.0 without gapping: 1036 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1152 length of database: 16,821,457 effective HSP length: 78 effective length of database: 12,156,433 effective search space used: 1227799733 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -