BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= S06A01NCLL0001_O19 (574 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AY035716-1|AAK61362.1| 136|Anopheles gambiae histone 3A protein. 273 3e-75 Y09952-1|CAA71083.1| 115|Anopheles gambiae histone H3 protein. 224 1e-60 AM422833-1|CAM12801.1| 2139|Anopheles gambiae voltage-gated sodi... 25 2.3 >AY035716-1|AAK61362.1| 136|Anopheles gambiae histone 3A protein. Length = 136 Score = 273 bits (669), Expect = 3e-75 Identities = 134/136 (98%), Positives = 135/136 (99%) Frame = +2 Query: 116 MARTKQTARKSTGGKAPRKQLATKAVRKSAPTTGGVKKPHRYRPGTVALREIRRYQKSTE 295 MARTKQTARKSTGGKAPRKQLATKA RKSAP+TGGVKKPHRYRPGTVALREIRRYQKSTE Sbjct: 1 MARTKQTARKSTGGKAPRKQLATKAARKSAPSTGGVKKPHRYRPGTVALREIRRYQKSTE 60 Query: 296 LLIRKLPFQRLVREIAQDFKTDLRFQSAAIGALQEASEAYLVGLFEDTNLCAIHAKRVTI 475 LLIRKLPFQRLVREIAQDFKTDLRFQSAAIGALQEASEAYLVGLFEDTNLCAIHAKRVTI Sbjct: 61 LLIRKLPFQRLVREIAQDFKTDLRFQSAAIGALQEASEAYLVGLFEDTNLCAIHAKRVTI 120 Query: 476 MPKDIQLARRIRGERA 523 MPKDIQLARRIRGERA Sbjct: 121 MPKDIQLARRIRGERA 136 >Y09952-1|CAA71083.1| 115|Anopheles gambiae histone H3 protein. Length = 115 Score = 224 bits (548), Expect = 1e-60 Identities = 109/115 (94%), Positives = 111/115 (96%) Frame = +2 Query: 122 RTKQTARKSTGGKAPRKQLATKAVRKSAPTTGGVKKPHRYRPGTVALREIRRYQKSTELL 301 RTKQTARKSTGGKAPRKQLA KA RKSAP TGGVKKPHRYRPGTVALREIRRYQKSTELL Sbjct: 1 RTKQTARKSTGGKAPRKQLARKAARKSAPATGGVKKPHRYRPGTVALREIRRYQKSTELL 60 Query: 302 IRKLPFQRLVREIAQDFKTDLRFQSAAIGALQEASEAYLVGLFEDTNLCAIHAKR 466 IRKLPFQRLVREIAQDFKTDLRFQS+A+ ALQEASEAYLVGLFEDTNLCAIHAKR Sbjct: 61 IRKLPFQRLVREIAQDFKTDLRFQSSAVMALQEASEAYLVGLFEDTNLCAIHAKR 115 >AM422833-1|CAM12801.1| 2139|Anopheles gambiae voltage-gated sodium channel alpha subunitprotein. Length = 2139 Score = 24.6 bits (51), Expect = 2.3 Identities = 12/33 (36%), Positives = 17/33 (51%) Frame = -1 Query: 349 VLSNFSNESLERQLADQQLRRFLIATNFSKRYS 251 +LSNF + SL AD + + A N R+S Sbjct: 1029 LLSNFGSSSLSAPTADNETNKIAEAFNRISRFS 1061 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 572,195 Number of Sequences: 2352 Number of extensions: 10328 Number of successful extensions: 64 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 62 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 64 length of database: 563,979 effective HSP length: 61 effective length of database: 420,507 effective search space used: 54245403 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -