BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= S06A01NCLL0001_O18 (545 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 05_01_0142 - 940421-940701,941262-941574 33 0.20 01_07_0082 - 40965947-40967023 32 0.26 05_03_0458 + 14280953-14281866,14281964-14282912 31 0.60 05_03_0035 - 7592177-7592938 31 0.79 05_03_0033 - 7585267-7586028 31 0.79 04_03_0904 + 20717005-20718087 31 0.79 07_01_0479 + 3606663-3607448 30 1.0 09_02_0543 + 10427321-10428315,10428440-10429154 30 1.4 06_03_0905 + 25843547-25844314 30 1.4 02_02_0015 + 6109552-6109650,6110006-6110078,6111937-6111998,611... 29 1.8 01_01_0082 + 625198-625719 29 1.8 10_01_0286 - 2978630-2979075,2980050-2980194 29 2.4 08_02_0743 - 20647440-20647927,20647997-20648426,20650127-206505... 29 2.4 07_03_1421 - 26451012-26451155,26451256-26451322,26451605-264516... 29 2.4 07_01_0227 - 1663375-1665405 29 3.2 03_02_0631 + 9969841-9969868,9969965-9970082,9970186-9970828,997... 29 3.2 02_03_0120 + 15463163-15465250 29 3.2 08_01_0902 - 8891875-8891916,8893841-8894411,8895682-8895728 28 4.2 07_01_0674 + 5047503-5047646,5047808-5047901,5048743-5048828,504... 28 4.2 04_03_0781 + 19572795-19573540,19573906-19573956,19574179-195742... 28 4.2 03_02_0765 + 11000724-11002496 28 4.2 06_01_0486 - 3455030-3455770 28 5.6 05_03_0040 - 7646525-7647775 28 5.6 04_04_0271 + 24069218-24069433,24069695-24070365,24070458-24073410 28 5.6 02_01_0778 - 5799260-5799273,5799377-5799447,5800163-5800578 28 5.6 01_06_1682 - 39130696-39131705,39132355-39132583 28 5.6 01_05_0562 - 23307526-23307875,23308149-23308452,23308543-23308647 28 5.6 03_05_0388 + 23726957-23727418,23730016-23730262,23731072-237312... 27 7.4 03_02_0342 - 7645323-7645909,7646323-7646491 27 7.4 03_02_0149 + 5933134-5933207,5935039-5935267,5935370-5935468,593... 27 7.4 02_03_0132 - 15584673-15584789,15584957-15585054,15585151-15585550 27 7.4 01_06_0823 + 32234588-32234936,32236354-32237093,32237260-322373... 27 7.4 01_03_0117 + 12684729-12685886,12685978-12686145,12686292-126863... 27 7.4 01_01_0070 - 542603-542686,542803-543441 27 7.4 12_02_1174 - 26696869-26698191 27 9.8 12_02_0643 - 21461123-21461902 27 9.8 11_06_0202 - 21184217-21184503,21184622-21184982 27 9.8 08_01_0870 - 8491020-8491109,8491523-8491660,8492442-8492568,849... 27 9.8 06_03_1310 + 29238644-29240260 27 9.8 04_04_0940 - 29539138-29539626,29540125-29540531,29540631-295406... 27 9.8 03_05_0136 + 21158917-21159939,21160183-21160241,21160259-211602... 27 9.8 03_03_0215 - 15492934-15493023,15493449-15493547,15493578-154936... 27 9.8 02_05_0686 - 30900748-30902167,30903442-30904742 27 9.8 02_01_0786 - 5863278-5863736,5863864-5864281,5864368-5864618,586... 27 9.8 >05_01_0142 - 940421-940701,941262-941574 Length = 197 Score = 32.7 bits (71), Expect = 0.20 Identities = 16/42 (38%), Positives = 19/42 (45%), Gaps = 1/42 (2%) Frame = +3 Query: 27 FPNQNYERPPXPLNKPKTIYGPPK-VYGPPKSYGPPKLGPPK 149 +P Q Y PP P Y PP Y PP PP+ G P+ Sbjct: 35 YPPQGYPPPPGAYPPPPGAYPPPPGAYPPPPGAYPPQHGYPQ 76 >01_07_0082 - 40965947-40967023 Length = 358 Score = 32.3 bits (70), Expect = 0.26 Identities = 17/41 (41%), Positives = 20/41 (48%), Gaps = 1/41 (2%) Frame = +3 Query: 27 FPNQNYERPPXPLNKPKTIYGPPKVYGPPK-SYGPPKLGPP 146 +P Q+ PP N+P T Y PP Y P S P K G P Sbjct: 196 YPPQSAYPPPGKGNEPSTAYPPPAGYPPATGSSKPAKAGEP 236 >05_03_0458 + 14280953-14281866,14281964-14282912 Length = 620 Score = 31.1 bits (67), Expect = 0.60 Identities = 15/45 (33%), Positives = 19/45 (42%) Frame = -2 Query: 535 RSGVPYIGAGKLAPESKFDPKVPPKSTPWLSAKFTPKSPPKFVPM 401 R+ P + P S P VPP T S +P SPP P+ Sbjct: 27 RNAAPSPPSSNSTPTSSTTPTVPPSLTTTSSPSSSPSSPPPLPPL 71 >05_03_0035 - 7592177-7592938 Length = 253 Score = 30.7 bits (66), Expect = 0.79 Identities = 17/31 (54%), Positives = 19/31 (61%) Frame = -2 Query: 505 KLAPESKFDPKVPPKSTPWLSAKFTPKSPPK 413 K PESK +PK +STP AK PKS PK Sbjct: 110 KAEPESKPEPKA--ESTPQPEAKSEPKSEPK 138 Score = 30.7 bits (66), Expect = 0.79 Identities = 14/30 (46%), Positives = 17/30 (56%) Frame = -2 Query: 493 ESKFDPKVPPKSTPWLSAKFTPKSPPKFVP 404 E K +PK P+S P K PKS PK+ P Sbjct: 146 EPKSEPKSEPQSEPNPETKAEPKSEPKYEP 175 Score = 29.9 bits (64), Expect = 1.4 Identities = 15/33 (45%), Positives = 19/33 (57%), Gaps = 2/33 (6%) Frame = -2 Query: 496 PESKFDPKVPPK--STPWLSAKFTPKSPPKFVP 404 PE+K +PK PK S P+ K PKS P+ P Sbjct: 127 PEAKSEPKSEPKPKSEPYAEPKSEPKSEPQSEP 159 >05_03_0033 - 7585267-7586028 Length = 253 Score = 30.7 bits (66), Expect = 0.79 Identities = 17/31 (54%), Positives = 19/31 (61%) Frame = -2 Query: 505 KLAPESKFDPKVPPKSTPWLSAKFTPKSPPK 413 K PESK +PK +STP AK PKS PK Sbjct: 110 KAEPESKPEPKA--ESTPQPEAKSEPKSEPK 138 Score = 29.5 bits (63), Expect = 1.8 Identities = 15/34 (44%), Positives = 18/34 (52%) Frame = -2 Query: 505 KLAPESKFDPKVPPKSTPWLSAKFTPKSPPKFVP 404 +L E K +PK P+S P K PKS PK P Sbjct: 142 ELYAEPKSEPKSEPQSEPNPETKAEPKSEPKSEP 175 >04_03_0904 + 20717005-20718087 Length = 360 Score = 30.7 bits (66), Expect = 0.79 Identities = 17/44 (38%), Positives = 20/44 (45%) Frame = +3 Query: 18 TRVFPNQNYERPPXPLNKPKTIYGPPKVYGPPKSYGPPKLGPPK 149 T V P E+PP P + PK PPK + PP PPK Sbjct: 36 TPVKPAPKPEKPPKEHKPPH--HHEPKPEKPPKEHKPPAYTPPK 77 >07_01_0479 + 3606663-3607448 Length = 261 Score = 30.3 bits (65), Expect = 1.0 Identities = 15/36 (41%), Positives = 20/36 (55%), Gaps = 1/36 (2%) Frame = +3 Query: 48 RPPXP-LNKPKTIYGPPKVYGPPKSYGPPKLGPPKL 152 RPP P L+ P Y P+V PP PP + PP++ Sbjct: 150 RPPMPNLSAPPVAY--PQVVRPPPGQMPPPMRPPQM 183 Score = 27.5 bits (58), Expect = 7.4 Identities = 15/37 (40%), Positives = 20/37 (54%) Frame = +3 Query: 42 YERPPXPLNKPKTIYGPPKVYGPPKSYGPPKLGPPKL 152 ++RPP P GPP GP GPP +GPP++ Sbjct: 187 FQRPPGV--PPAFPGGPPPPPGPFMR-GPPPMGPPQV 220 >09_02_0543 + 10427321-10428315,10428440-10429154 Length = 569 Score = 29.9 bits (64), Expect = 1.4 Identities = 20/55 (36%), Positives = 24/55 (43%), Gaps = 2/55 (3%) Frame = -2 Query: 523 PYIGAGKLAPESKFDPKVPPKSTPWLS--AKFTPKSPPKFVPMFVSTVVTVGSCI 365 P G G A S P P + PW++ A P PP P+ V VTV CI Sbjct: 66 PPPGPGPAAAPSPHSPS--PSNAPWVAPAADIPPPPPPPPNPLPVIIAVTVPVCI 118 >06_03_0905 + 25843547-25844314 Length = 255 Score = 29.9 bits (64), Expect = 1.4 Identities = 13/33 (39%), Positives = 17/33 (51%), Gaps = 1/33 (3%) Frame = +3 Query: 51 PPXPLNKPKTIYGPPKVY-GPPKSYGPPKLGPP 146 P P+ P + GPP Y PP + P +GPP Sbjct: 104 PTPPVTTPPVVVGPPVTYPTPPVTTPPVVVGPP 136 Score = 27.9 bits (59), Expect = 5.6 Identities = 15/40 (37%), Positives = 17/40 (42%), Gaps = 1/40 (2%) Frame = +3 Query: 30 PNQNYERPPXPLNKPKTIYGPPKVYGPPKSY-GPPKLGPP 146 P RPP + PP V GPP +Y PP PP Sbjct: 91 PKGPVTRPPPVTYPTPPVTTPPVVVGPPVTYPTPPVTTPP 130 >02_02_0015 + 6109552-6109650,6110006-6110078,6111937-6111998, 6112315-6112376,6112463-6112556,6112673-6113227, 6113379-6113870,6113967-6114137,6115713-6115817, 6115903-6116052,6116372-6116498,6116585-6116648, 6117147-6117203,6117423-6117555,6117660-6117746 Length = 776 Score = 29.5 bits (63), Expect = 1.8 Identities = 11/28 (39%), Positives = 17/28 (60%) Frame = +3 Query: 51 PPXPLNKPKTIYGPPKVYGPPKSYGPPK 134 PP P++ P+ I PP+ PP+ PP+ Sbjct: 275 PPRPIDPPRPI-DPPRPIDPPRPIDPPR 301 Score = 29.5 bits (63), Expect = 1.8 Identities = 12/32 (37%), Positives = 18/32 (56%) Frame = +3 Query: 51 PPXPLNKPKTIYGPPKVYGPPKSYGPPKLGPP 146 PP P++ P+ I PP+ PP+ G + PP Sbjct: 281 PPRPIDPPRPI-DPPRPIDPPRPNGTRTIEPP 311 Score = 28.3 bits (60), Expect = 4.2 Identities = 15/41 (36%), Positives = 21/41 (51%), Gaps = 1/41 (2%) Frame = +3 Query: 30 PNQNYERPPXPLNKPKTIYGPPKVYGPPKSYGPPK-LGPPK 149 P PP P N +TI PP+ PP+ PP+ + PP+ Sbjct: 257 PQLRVGEPPKP-NVARTI-DPPRPIDPPRPIDPPRPIDPPR 295 >01_01_0082 + 625198-625719 Length = 173 Score = 29.5 bits (63), Expect = 1.8 Identities = 16/37 (43%), Positives = 17/37 (45%), Gaps = 2/37 (5%) Frame = +3 Query: 42 YERPPXPLNKPKTIY--GPPKVYGPPKSYGPPKLGPP 146 Y PP P P +Y PP VY PP S P PP Sbjct: 50 YASPPPPDVLPTPVYYPPPPPVYYPPPSPPPVAYPPP 86 >10_01_0286 - 2978630-2979075,2980050-2980194 Length = 196 Score = 29.1 bits (62), Expect = 2.4 Identities = 13/32 (40%), Positives = 17/32 (53%) Frame = +3 Query: 18 TRVFPNQNYERPPXPLNKPKTIYGPPKVYGPP 113 T+ P + ++PP P KP YG P Y PP Sbjct: 164 TKPAPKPHPDQPPHP--KPTPTYGTPSPYHPP 193 >08_02_0743 - 20647440-20647927,20647997-20648426,20650127-20650570, 20650639-20650692 Length = 471 Score = 29.1 bits (62), Expect = 2.4 Identities = 18/50 (36%), Positives = 21/50 (42%), Gaps = 1/50 (2%) Frame = +3 Query: 3 LHEFGTRVFPNQNYERPPXPLNKPKTIYG-PPKVYGPPKSYGPPKLGPPK 149 + E G +F NY R P PK G PPK P PPK P+ Sbjct: 64 MKESGELIFLKNNYFRADAPDAPPKRGRGRPPKPRDPNAPPPPPKPSSPR 113 >07_03_1421 - 26451012-26451155,26451256-26451322,26451605-26451657, 26451736-26451806,26453340-26453482,26453858-26453919, 26454008-26454100,26454203-26454314,26454432-26454547, 26454625-26454787,26454829-26455349,26455429-26455528, 26457472-26457552,26457666-26457877 Length = 645 Score = 29.1 bits (62), Expect = 2.4 Identities = 15/40 (37%), Positives = 21/40 (52%), Gaps = 4/40 (10%) Frame = +3 Query: 15 GTRVFPNQN----YERPPXPLNKPKTIYGPPKVYGPPKSY 122 GT++ P QN +RPP P N+ K +G P K+Y Sbjct: 108 GTKIQPQQNPCRAQKRPPKPGNRVKRTFGGPPDLKKEKAY 147 >07_01_0227 - 1663375-1665405 Length = 676 Score = 28.7 bits (61), Expect = 3.2 Identities = 22/76 (28%), Positives = 35/76 (46%), Gaps = 1/76 (1%) Frame = +3 Query: 321 APLLNVQNIPLELPPIQLPTVTTVETNIGTNFGGDFGVNFADSHGVDFGGTFGSNFDSGA 500 A ++V PL + + P ++ V N+ T + F+ S G+ G + + G Sbjct: 207 ATQIDVTLAPLGIGRPKRPLLSVVH-NLSTVLTDQAYLGFSSSTGLSTGHHYVLGWSFGL 265 Query: 501 NLPAPIYG-TPLLSLP 545 N+PAPI T L LP Sbjct: 266 NIPAPIIDPTKLPKLP 281 >03_02_0631 + 9969841-9969868,9969965-9970082,9970186-9970828, 9971146-9971935,9972002-9972051,9972618-9972704 Length = 571 Score = 28.7 bits (61), Expect = 3.2 Identities = 15/39 (38%), Positives = 17/39 (43%), Gaps = 6/39 (15%) Frame = +3 Query: 54 PXPLNKPKTIYGPPKV------YGPPKSYGPPKLGPPKL 152 P P KP + PP PP + PPKL PP L Sbjct: 91 PPPAQKPSKVSPPPPPPQKSAKVSPPPAAKPPKLSPPNL 129 >02_03_0120 + 15463163-15465250 Length = 695 Score = 28.7 bits (61), Expect = 3.2 Identities = 16/45 (35%), Positives = 17/45 (37%) Frame = +3 Query: 12 FGTRVFPNQNYERPPXPLNKPKTIYGPPKVYGPPKSYGPPKLGPP 146 F T FPN +Y PP P P P S PP PP Sbjct: 272 FRTFGFPNSSYAPPPTKYIGPMPPNNQPLPPPPSPSPSPPPPSPP 316 >08_01_0902 - 8891875-8891916,8893841-8894411,8895682-8895728 Length = 219 Score = 28.3 bits (60), Expect = 4.2 Identities = 21/66 (31%), Positives = 26/66 (39%), Gaps = 4/66 (6%) Frame = -1 Query: 284 DWFRR-SIVWFRC---EWFRQEFWYFKWCTVRRLGLGRAIRLFRRSISEFRWPEFRWXVR 117 D FR + WFRC W R FW +RRL L R + F +FR R Sbjct: 114 DGFRSLEVFWFRCLDDGWLRLRFWGAAMPRLRRLRLYLRANGLRLHGNYFGMRDFRSLTR 173 Query: 116 FWRAID 99 +D Sbjct: 174 VHVTVD 179 >07_01_0674 + 5047503-5047646,5047808-5047901,5048743-5048828, 5049380-5049429,5049517-5049586,5049668-5049749, 5049867-5050267,5050414-5050941,5051823-5052044 Length = 558 Score = 28.3 bits (60), Expect = 4.2 Identities = 15/32 (46%), Positives = 16/32 (50%) Frame = +3 Query: 51 PPXPLNKPKTIYGPPKVYGPPKSYGPPKLGPP 146 PP P KP I G P + PP PP GPP Sbjct: 232 PPPPPPKPANIAGAPGLPLPPPP--PPPPGPP 261 >04_03_0781 + 19572795-19573540,19573906-19573956,19574179-19574251, 19574772-19574876 Length = 324 Score = 28.3 bits (60), Expect = 4.2 Identities = 15/44 (34%), Positives = 19/44 (43%) Frame = +3 Query: 354 ELPPIQLPTVTTVETNIGTNFGGDFGVNFADSHGVDFGGTFGSN 485 E P+ PT TT + GGD N H + GT GS+ Sbjct: 33 EREPLPPPTTTTRNQRLQLQLGGDGHHNHHHHHHQEVAGTSGSS 76 >03_02_0765 + 11000724-11002496 Length = 590 Score = 28.3 bits (60), Expect = 4.2 Identities = 15/40 (37%), Positives = 17/40 (42%) Frame = +3 Query: 405 GTNFGGDFGVNFADSHGVDFGGTFGSNFDSGANLPAPIYG 524 G GG FG S G FGG FG+ +G A G Sbjct: 521 GGGKGGGFGGGLGGSSGSGFGGGFGAGGGAGGGAGAGFGG 560 >06_01_0486 - 3455030-3455770 Length = 246 Score = 27.9 bits (59), Expect = 5.6 Identities = 11/25 (44%), Positives = 16/25 (64%) Frame = -2 Query: 478 PKVPPKSTPWLSAKFTPKSPPKFVP 404 P +PP + P++ TP SPP +VP Sbjct: 114 PYIPPPTPPYVPPP-TPPSPPPYVP 137 >05_03_0040 - 7646525-7647775 Length = 416 Score = 27.9 bits (59), Expect = 5.6 Identities = 15/38 (39%), Positives = 17/38 (44%) Frame = +3 Query: 30 PNQNYERPPXPLNKPKTIYGPPKVYGPPKSYGPPKLGP 143 P E P P KPK PK PPK + PP + P Sbjct: 378 PKPYPEPKPEPKPKPKP---EPKPEAPPKKHKPPHIPP 412 >04_04_0271 + 24069218-24069433,24069695-24070365,24070458-24073410 Length = 1279 Score = 27.9 bits (59), Expect = 5.6 Identities = 10/30 (33%), Positives = 19/30 (63%) Frame = -3 Query: 474 KFLQNQPHGYQRNLHQNLRQSLYQCLFQRS 385 +F+ PHGY+ ++H+ +Q QC+ Q + Sbjct: 464 EFIVKLPHGYETHVHK--QQQFLQCMLQHA 491 >02_01_0778 - 5799260-5799273,5799377-5799447,5800163-5800578 Length = 166 Score = 27.9 bits (59), Expect = 5.6 Identities = 13/29 (44%), Positives = 16/29 (55%) Frame = +3 Query: 405 GTNFGGDFGVNFADSHGVDFGGTFGSNFD 491 G+ GGD+ NF G FGG FG+ D Sbjct: 37 GSGGGGDYA-NFGGRGGSSFGGGFGTGSD 64 >01_06_1682 - 39130696-39131705,39132355-39132583 Length = 412 Score = 27.9 bits (59), Expect = 5.6 Identities = 12/34 (35%), Positives = 14/34 (41%) Frame = +3 Query: 30 PNQNYERPPXPLNKPKTIYGPPKVYGPPKSYGPP 131 P +Y+ PP N P YG P Y PP Sbjct: 245 PPNSYQAPPTSYNHPPPPYGYNSPIPPTNKYLPP 278 >01_05_0562 - 23307526-23307875,23308149-23308452,23308543-23308647 Length = 252 Score = 27.9 bits (59), Expect = 5.6 Identities = 16/35 (45%), Positives = 17/35 (48%), Gaps = 1/35 (2%) Frame = +3 Query: 48 RPPXPLNKPKTIYGPPKVYGPPKSYGP-PKLGPPK 149 +PP P KPK PK P GP PK PPK Sbjct: 179 KPPKPGPKPKPPKPGPKPKPKPPKPGPKPKPKPPK 213 Score = 27.1 bits (57), Expect = 9.8 Identities = 17/37 (45%), Positives = 18/37 (48%), Gaps = 1/37 (2%) Frame = +3 Query: 42 YERPPXPLNKPKTIYGPPKVYGPPKSYGPPKLGP-PK 149 + P P KPK PPK PK PPK GP PK Sbjct: 153 FHHGPKPGPKPKPKPSPPKPKPGPKP-KPPKPGPKPK 188 Score = 27.1 bits (57), Expect = 9.8 Identities = 16/37 (43%), Positives = 18/37 (48%), Gaps = 3/37 (8%) Frame = +3 Query: 48 RPPXPLNKPKTIY---GPPKVYGPPKSYGPPKLGPPK 149 +PP P KPK GP PPK PK GPP+ Sbjct: 188 KPPKPGPKPKPKPPKPGPKPKPKPPKPGPKPKPGPPQ 224 >03_05_0388 + 23726957-23727418,23730016-23730262,23731072-23731220, 23731313-23731597,23731665-23731889,23734251-23734445 Length = 520 Score = 27.5 bits (58), Expect = 7.4 Identities = 9/16 (56%), Positives = 13/16 (81%) Frame = +3 Query: 84 YGPPKVYGPPKSYGPP 131 +GPP+ +GPP S+ PP Sbjct: 304 WGPPQPWGPPPSHLPP 319 >03_02_0342 - 7645323-7645909,7646323-7646491 Length = 251 Score = 27.5 bits (58), Expect = 7.4 Identities = 15/37 (40%), Positives = 16/37 (43%), Gaps = 5/37 (13%) Frame = +3 Query: 51 PPXPLNKPKTIYGPP-----KVYGPPKSYGPPKLGPP 146 PP P P Y PP + P SYGPP PP Sbjct: 175 PPPPPRPPAPEYKPPTPTLTPIPTPEPSYGPPAPKPP 211 >03_02_0149 + 5933134-5933207,5935039-5935267,5935370-5935468, 5935582-5935616,5935694-5935769,5936552-5936662, 5937001-5937087,5937302-5937395,5937489-5937606, 5938047-5938542,5939263-5939298,5940047-5940578, 5940668-5940792 Length = 703 Score = 27.5 bits (58), Expect = 7.4 Identities = 12/23 (52%), Positives = 12/23 (52%) Frame = -2 Query: 478 PKVPPKSTPWLSAKFTPKSPPKF 410 P PPKS P K P PPKF Sbjct: 584 PMAPPKSMPPPPPKSMPPPPPKF 606 >02_03_0132 - 15584673-15584789,15584957-15585054,15585151-15585550 Length = 204 Score = 27.5 bits (58), Expect = 7.4 Identities = 15/47 (31%), Positives = 20/47 (42%) Frame = -2 Query: 478 PKVPPKSTPWLSAKFTPKSPPKFVPMFVSTVVTVGSCIGGSSKGMFW 338 P +P K +P + P PP VP + G GS+ G FW Sbjct: 79 PTIPVKFSPPAAPVKVPPPPPVQVPPPQYEKASAGGKHDGSAFGFFW 125 >01_06_0823 + 32234588-32234936,32236354-32237093,32237260-32237343, 32237909-32239263,32240399-32240460,32240544-32241144, 32241229-32241310,32241778-32241840 Length = 1111 Score = 27.5 bits (58), Expect = 7.4 Identities = 15/31 (48%), Positives = 15/31 (48%) Frame = +3 Query: 51 PPXPLNKPKTIYGPPKVYGPPKSYGPPKLGP 143 PP P P I PP V PP S PP L P Sbjct: 985 PPPPSPPPLPITQPPSVPPPPNS--PPPLQP 1013 >01_03_0117 + 12684729-12685886,12685978-12686145,12686292-12686336, 12686438-12687280 Length = 737 Score = 27.5 bits (58), Expect = 7.4 Identities = 15/43 (34%), Positives = 22/43 (51%), Gaps = 2/43 (4%) Frame = +3 Query: 24 VFPNQNYERPPXPLNKPKTIYGPPKVYG--PPKSYGPPKLGPP 146 V P Q +RPP P KP + PP++ PP ++ P + P Sbjct: 245 VAPVQPPQRPPAPATKPPPSF-PPQLAPTMPPPAHAPAETPAP 286 >01_01_0070 - 542603-542686,542803-543441 Length = 240 Score = 27.5 bits (58), Expect = 7.4 Identities = 13/32 (40%), Positives = 15/32 (46%) Frame = +3 Query: 51 PPXPLNKPKTIYGPPKVYGPPKSYGPPKLGPP 146 PP P P PP V PP + PP + PP Sbjct: 84 PPTPKKAPPPPVTPPPVTPPPVT--PPPVSPP 113 >12_02_1174 - 26696869-26698191 Length = 440 Score = 27.1 bits (57), Expect = 9.8 Identities = 13/32 (40%), Positives = 15/32 (46%) Frame = +3 Query: 51 PPXPLNKPKTIYGPPKVYGPPKSYGPPKLGPP 146 PP P + +T PP P K PP L PP Sbjct: 124 PPPPPPRTRTRVEPPHRPPPVKPQPPPSLPPP 155 >12_02_0643 - 21461123-21461902 Length = 259 Score = 27.1 bits (57), Expect = 9.8 Identities = 12/37 (32%), Positives = 18/37 (48%) Frame = +3 Query: 36 QNYERPPXPLNKPKTIYGPPKVYGPPKSYGPPKLGPP 146 Q+ RPP P+ P + G P++ PP+ PP Sbjct: 194 QSSRRPPSRTPPPERRESPSPLRGRPRTPPPPRPRPP 230 >11_06_0202 - 21184217-21184503,21184622-21184982 Length = 215 Score = 27.1 bits (57), Expect = 9.8 Identities = 14/34 (41%), Positives = 15/34 (44%) Frame = -2 Query: 511 AGKLAPESKFDPKVPPKSTPWLSAKFTPKSPPKF 410 AGKLA P P + P L P SPP F Sbjct: 140 AGKLAESPAATPAQSPTAAPSLPQAPKPSSPPPF 173 >08_01_0870 - 8491020-8491109,8491523-8491660,8492442-8492568, 8492667-8492801,8493262-8493731 Length = 319 Score = 27.1 bits (57), Expect = 9.8 Identities = 12/32 (37%), Positives = 16/32 (50%) Frame = -2 Query: 535 RSGVPYIGAGKLAPESKFDPKVPPKSTPWLSA 440 R GV +G G APE P+ P+ +L A Sbjct: 52 RGGVVGVGGGGAAPELSLGPEPTPRGVAYLRA 83 >06_03_1310 + 29238644-29240260 Length = 538 Score = 27.1 bits (57), Expect = 9.8 Identities = 15/41 (36%), Positives = 18/41 (43%), Gaps = 2/41 (4%) Frame = +3 Query: 30 PNQNYERPPXPLNK-PKTIYGPPKVYGP-PKSYGPPKLGPP 146 P + PP P + P + PP Y PKS PP PP Sbjct: 391 PRRTPPTPPPPSSPTPSHLPPPPPTYSESPKSSMPPSTSPP 431 >04_04_0940 - 29539138-29539626,29540125-29540531,29540631-29540662, 29540809-29541086,29541164-29542515,29542616-29542874 Length = 938 Score = 27.1 bits (57), Expect = 9.8 Identities = 14/25 (56%), Positives = 14/25 (56%), Gaps = 1/25 (4%) Frame = +3 Query: 450 HGVDFGGTFGS-NFDSGANLPAPIY 521 H VDF G G FDSG NL P Y Sbjct: 376 HQVDFLGATGPVKFDSGGNLIQPAY 400 >03_05_0136 + 21158917-21159939,21160183-21160241,21160259-21160294, 21160345-21160387,21160582-21160698,21162090-21162179, 21162329-21162436,21162547-21162588 Length = 505 Score = 27.1 bits (57), Expect = 9.8 Identities = 12/23 (52%), Positives = 18/23 (78%) Frame = +1 Query: 436 ISLIAMGLILEELLDQTLTRELI 504 ISL +MG+IL++ LD T+T + I Sbjct: 427 ISLPSMGIILQQALDLTMTTKTI 449 >03_03_0215 - 15492934-15493023,15493449-15493547,15493578-15493634, 15493635-15493902,15494019-15494086 Length = 193 Score = 27.1 bits (57), Expect = 9.8 Identities = 18/48 (37%), Positives = 23/48 (47%) Frame = +3 Query: 348 PLELPPIQLPTVTTVETNIGTNFGGDFGVNFADSHGVDFGGTFGSNFD 491 P LPP Q P TT + G+ GD G + + G GG GS+ D Sbjct: 18 PPSLPPPQAPRATTTD---GSG-AGDHGSDSGGNSGKGSGGGGGSDDD 61 >02_05_0686 - 30900748-30902167,30903442-30904742 Length = 906 Score = 27.1 bits (57), Expect = 9.8 Identities = 15/35 (42%), Positives = 16/35 (45%), Gaps = 3/35 (8%) Frame = +3 Query: 54 PXPLNKPKTIYGPPKVYGPPK---SYGPPKLGPPK 149 P P PK PP GPP + GPP PPK Sbjct: 326 PPPPPPPKAAPPPPPPKGPPPPPPAKGPPPPPPPK 360 >02_01_0786 - 5863278-5863736,5863864-5864281,5864368-5864618, 5864727-5864950,5865248-5865569 Length = 557 Score = 27.1 bits (57), Expect = 9.8 Identities = 16/47 (34%), Positives = 19/47 (40%) Frame = +3 Query: 3 LHEFGTRVFPNQNYERPPXPLNKPKTIYGPPKVYGPPKSYGPPKLGP 143 L F R PN Y P L YG P ++ P S+ P GP Sbjct: 513 LQRFEIRTSPN--YVHAPTVLMLLYPQYGAPLIFRPLSSHPPDSTGP 557 Database: rice Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 15,357,580 Number of Sequences: 37544 Number of extensions: 352631 Number of successful extensions: 1470 Number of sequences better than 10.0: 44 Number of HSP's better than 10.0 without gapping: 1152 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1424 length of database: 14,793,348 effective HSP length: 78 effective length of database: 11,864,916 effective search space used: 1222086348 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -