BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= S06A01NCLL0001_O18 (545 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At5g59170.1 68418.m07416 proline-rich family protein contains pr... 36 0.023 At5g26080.1 68418.m03103 proline-rich family protein contains pr... 34 0.054 At4g13340.1 68417.m02084 leucine-rich repeat family protein / ex... 32 0.22 At3g20850.1 68416.m02636 proline-rich family protein contains pr... 32 0.22 At2g27380.1 68415.m03302 proline-rich family protein contains pr... 32 0.29 At4g33970.1 68417.m04820 leucine-rich repeat family protein / ex... 31 0.38 At1g53260.1 68414.m06035 hypothetical protein low similarity to ... 31 0.50 At4g38770.1 68417.m05490 proline-rich family protein (PRP4) simi... 31 0.66 At3g49840.1 68416.m05449 proline-rich family protein contains pr... 31 0.66 At4g36870.1 68417.m05228 BEL1-like homeobox 2 protein (BLH2) 30 0.88 At5g40490.1 68418.m04910 RNA recognition motif (RRM)-containing ... 30 1.2 At3g14010.1 68416.m01769 hydroxyproline-rich glycoprotein family... 30 1.2 At2g15880.1 68415.m01820 leucine-rich repeat family protein / ex... 30 1.2 At1g62500.1 68414.m07052 protease inhibitor/seed storage/lipid t... 30 1.2 At1g12040.1 68414.m01390 leucine-rich repeat family protein / ex... 30 1.2 At3g22800.1 68416.m02874 leucine-rich repeat family protein / ex... 29 1.5 At2g48030.1 68415.m06012 endonuclease/exonuclease/phosphatase fa... 29 2.7 At1g31750.1 68414.m03895 proline-rich family protein contains pr... 29 2.7 At5g23950.1 68418.m02812 C2 domain-containing protein similar to... 28 3.5 At4g08380.1 68417.m01384 proline-rich extensin-like family prote... 28 3.5 At3g57410.1 68416.m06391 villin 3 (VLN3) nearly identical to vil... 28 3.5 At3g44340.1 68416.m04764 sec23/sec24 transport family protein co... 28 3.5 At1g54970.1 68414.m06278 proline-rich family protein similar to ... 28 3.5 At1g49490.1 68414.m05547 leucine-rich repeat family protein / ex... 28 3.5 At1g27750.1 68414.m03391 ubiquitin system component Cue domain-c... 28 3.5 At5g48920.1 68418.m06052 hydroxyproline-rich glycoprotein family... 28 4.7 At5g21160.1 68418.m02528 La domain-containing protein / proline-... 28 4.7 At4g33660.1 68417.m04781 expressed protein 28 4.7 At3g22120.1 68416.m02792 protease inhibitor/seed storage/lipid t... 28 4.7 At2g14890.2 68415.m01692 arabinogalactan-protein (AGP9) identica... 28 4.7 At2g14890.1 68415.m01693 arabinogalactan-protein (AGP9) identica... 28 4.7 At1g79730.1 68414.m09300 hydroxyproline-rich glycoprotein family... 28 4.7 At1g20130.1 68414.m02518 family II extracellular lipase, putativ... 28 4.7 At4g22470.1 68417.m03245 protease inhibitor/seed storage/lipid t... 27 6.2 At3g24480.1 68416.m03070 leucine-rich repeat family protein / ex... 27 6.2 At3g19020.1 68416.m02415 leucine-rich repeat family protein / ex... 27 6.2 At2g43150.1 68415.m05358 proline-rich extensin-like family prote... 27 6.2 At2g43010.2 68415.m05338 phytochrome-interacting factor 4 (PIF4)... 27 6.2 At2g43010.1 68415.m05337 phytochrome-interacting factor 4 (PIF4)... 27 6.2 At2g20850.1 68415.m02457 leucine-rich repeat protein kinase, put... 27 6.2 At1g70990.1 68414.m08190 proline-rich family protein 27 6.2 At1g70620.1 68414.m08138 cyclin-related contains weak similarity... 27 6.2 At1g62440.1 68414.m07044 leucine-rich repeat family protein / ex... 27 6.2 At1g61080.1 68414.m06877 proline-rich family protein 27 6.2 At1g10390.1 68414.m01171 nucleoporin family protein contains Pfa... 27 6.2 At5g42860.1 68418.m05224 expressed protein 27 8.2 At5g15780.1 68418.m01845 pollen Ole e 1 allergen and extensin fa... 27 8.2 At3g51180.1 68416.m05603 zinc finger (CCCH-type) family protein ... 27 8.2 At3g24550.1 68416.m03083 protein kinase family protein contains ... 27 8.2 At2g36020.1 68415.m04423 abscisic acid-responsive HVA22 family p... 27 8.2 At1g63830.2 68414.m07224 proline-rich family protein contains pr... 27 8.2 At1g63830.1 68414.m07223 proline-rich family protein contains pr... 27 8.2 At1g17060.1 68414.m02075 cytochrome P450, putative 41% identical... 27 8.2 At1g04860.1 68414.m00482 ubiquitin-specific protease 2 (UBP2) id... 27 8.2 >At5g59170.1 68418.m07416 proline-rich family protein contains proline-rich extensin domains, INTERPRO:IPR002965 Length = 288 Score = 35.5 bits (78), Expect = 0.023 Identities = 19/44 (43%), Positives = 22/44 (50%), Gaps = 3/44 (6%) Frame = +3 Query: 27 FPNQNYERPPXPLNKP-KTIYGPPKVYGPPKSYGPP--KLGPPK 149 +P YE PP P KT PP Y PP+ Y PP K PP+ Sbjct: 75 YPPPPYEHPPVKYPPPIKTYPHPPVKYPPPEQYPPPIKKYPPPE 118 Score = 32.7 bits (71), Expect = 0.16 Identities = 18/44 (40%), Positives = 21/44 (47%), Gaps = 2/44 (4%) Frame = +3 Query: 27 FPNQNYERPPXPLNKPKTIYGPP-KVYGPPKSYGPP-KLGPPKL 152 +P Q PP P Y PP K Y PP+ Y PP K PP + Sbjct: 166 YPPQEQYPPPIKKYPPPEKYPPPIKKYPPPEQYPPPIKKYPPPI 209 Score = 32.3 bits (70), Expect = 0.22 Identities = 17/44 (38%), Positives = 21/44 (47%), Gaps = 2/44 (4%) Frame = +3 Query: 27 FPNQNYERPPXPLNKPKTIYGPP-KVYG-PPKSYGPPKLGPPKL 152 +P + PP P P Y PP K Y PP Y PP+ PP + Sbjct: 68 YPPPIKKYPPPPYEHPPVKYPPPIKTYPHPPVKYPPPEQYPPPI 111 Score = 32.3 bits (70), Expect = 0.22 Identities = 16/42 (38%), Positives = 20/42 (47%), Gaps = 2/42 (4%) Frame = +3 Query: 30 PNQNYERPPXPLNKPKTIYGPPKVYGPPKSYGPP--KLGPPK 149 P + Y PP P+ P K Y PP+ Y PP K PP+ Sbjct: 90 PIKTYPHPPVKYPPPEQYPPPIKKYPPPEQYPPPIKKYPPPE 131 Score = 31.1 bits (67), Expect = 0.50 Identities = 18/40 (45%), Positives = 22/40 (55%), Gaps = 5/40 (12%) Frame = +3 Query: 45 ERPPXPLNK--PKTIYGPP-KVYGPPKSYGPP--KLGPPK 149 E+ P P+ K P Y PP K Y PP+ Y PP K PP+ Sbjct: 105 EQYPPPIKKYPPPEQYPPPIKKYPPPEQYSPPFKKYPPPE 144 Score = 31.1 bits (67), Expect = 0.50 Identities = 18/40 (45%), Positives = 22/40 (55%), Gaps = 5/40 (12%) Frame = +3 Query: 45 ERPPXPLNK--PKTIYGPP-KVYGPPKSYGPP--KLGPPK 149 E+ P P+ K P Y PP K Y PP+ Y PP K PP+ Sbjct: 118 EQYPPPIKKYPPPEQYSPPFKKYPPPEQYPPPIKKYPPPE 157 Score = 30.3 bits (65), Expect = 0.88 Identities = 18/42 (42%), Positives = 21/42 (50%), Gaps = 2/42 (4%) Frame = +3 Query: 30 PNQNYERPPXPLNKPKTIYGPP-KVYGPPKSYGPP-KLGPPK 149 P + Y PP P Y PP K Y PP+ Y PP K PP+ Sbjct: 129 PPEQYS-PPFKKYPPPEQYPPPIKKYPPPEHYPPPIKKYPPQ 169 Score = 29.1 bits (62), Expect = 2.0 Identities = 16/44 (36%), Positives = 21/44 (47%), Gaps = 3/44 (6%) Frame = +3 Query: 27 FPNQNYERPPXPLNKPKTIYGPPKV-YGPPKSYGPP--KLGPPK 149 +P + PP P+ Y PP Y PP+ Y PP K PP+ Sbjct: 153 YPPPEHYPPPIKKYPPQEQYPPPIKKYPPPEKYPPPIKKYPPPE 196 Score = 27.9 bits (59), Expect = 4.7 Identities = 16/37 (43%), Positives = 17/37 (45%), Gaps = 3/37 (8%) Frame = +3 Query: 30 PNQNYERPPXPLNKP--KTIYGPP-KVYGPPKSYGPP 131 P + Y PP P KT PP K Y PPK PP Sbjct: 221 PIKTYPHPPVKYPPPPYKTYPHPPIKTYPPPKECPPP 257 Score = 27.5 bits (58), Expect = 6.2 Identities = 17/43 (39%), Positives = 19/43 (44%), Gaps = 4/43 (9%) Frame = +3 Query: 30 PNQNYERPPXPLNKPKTIYGPP--KVYGPP--KSYGPPKLGPP 146 P + Y P P Y PP K Y P K+Y PPK PP Sbjct: 214 PPEEYPPPIKTYPHPPVKYPPPPYKTYPHPPIKTYPPPKECPP 256 Score = 27.1 bits (57), Expect = 8.2 Identities = 17/40 (42%), Positives = 21/40 (52%), Gaps = 5/40 (12%) Frame = +3 Query: 45 ERPPXPLNK--PKTIYGPP-KVYGPPKSYGPP--KLGPPK 149 E+ P P+ K P Y PP K Y P + Y PP K PP+ Sbjct: 144 EQYPPPIKKYPPPEHYPPPIKKYPPQEQYPPPIKKYPPPE 183 Score = 27.1 bits (57), Expect = 8.2 Identities = 17/40 (42%), Positives = 21/40 (52%), Gaps = 4/40 (10%) Frame = +3 Query: 45 ERPPXPLNK--PKTIYGPP-KVYGPPK-SYGPPKLGPPKL 152 E+ P P+ K P Y PP K Y PP Y PP+ PP + Sbjct: 183 EKYPPPIKKYPPPEQYPPPIKKYPPPIKKYPPPEEYPPPI 222 >At5g26080.1 68418.m03103 proline-rich family protein contains proline-rich extensin domains, INTERPRO:IPR002965 Length = 141 Score = 34.3 bits (75), Expect = 0.054 Identities = 14/30 (46%), Positives = 16/30 (53%) Frame = +3 Query: 42 YERPPXPLNKPKTIYGPPKVYGPPKSYGPP 131 Y PP P P TI PP VY P ++ PP Sbjct: 40 YSPPPPPYRSPVTIPPPPPVYSRPVAFPPP 69 Score = 31.1 bits (67), Expect = 0.50 Identities = 17/39 (43%), Positives = 18/39 (46%) Frame = +3 Query: 30 PNQNYERPPXPLNKPKTIYGPPKVYGPPKSYGPPKLGPP 146 P Y PP P+ P IY PP PP Y PP PP Sbjct: 69 PPPIYSPPPPPI-YPPPIYSPP----PPPIYPPPIYSPP 102 Score = 29.5 bits (63), Expect = 1.5 Identities = 13/34 (38%), Positives = 16/34 (47%), Gaps = 2/34 (5%) Frame = +3 Query: 51 PPXPLNKPKTIYGPPKVYGPPKS--YGPPKLGPP 146 PP ++P PP +Y PP Y PP PP Sbjct: 56 PPPVYSRPVAFPPPPPIYSPPPPPIYPPPIYSPP 89 Score = 27.9 bits (59), Expect = 4.7 Identities = 14/37 (37%), Positives = 19/37 (51%), Gaps = 2/37 (5%) Frame = +3 Query: 24 VFPNQNYERPPXPLNKPKTIYGPP--KVYGPPKSYGP 128 ++P Y PP P+ P IY PP + PPK + P Sbjct: 80 IYPPPIYSPPPPPI-YPPPIYSPPPTPISPPPKVHHP 115 >At4g13340.1 68417.m02084 leucine-rich repeat family protein / extensin family protein similar to extensin-like protein [Lycopersicon esculentum] gi|5917664|gb|AAD55979; contains leucine-rich repeats, Pfam:PF00560; contains proline rich extensin domains, INTERPRO:IPR002965 Length = 760 Score = 32.3 bits (70), Expect = 0.22 Identities = 14/33 (42%), Positives = 17/33 (51%), Gaps = 1/33 (3%) Frame = +3 Query: 51 PPXPL-NKPKTIYGPPKVYGPPKSYGPPKLGPP 146 PP P+ + P T+ PP PP Y PP PP Sbjct: 412 PPAPIFSTPPTLTSPPPPSPPPPVYSPPPPPPP 444 Score = 28.7 bits (61), Expect = 2.7 Identities = 13/32 (40%), Positives = 13/32 (40%) Frame = +3 Query: 51 PPXPLNKPKTIYGPPKVYGPPKSYGPPKLGPP 146 PP P P PP PP Y PP PP Sbjct: 426 PPPPSPPPPVYSPPPPPPPPPPVYSPPPPPPP 457 Score = 28.7 bits (61), Expect = 2.7 Identities = 14/35 (40%), Positives = 15/35 (42%), Gaps = 3/35 (8%) Frame = +3 Query: 51 PPXPLNKPKTIYGPPKVYGPPKS---YGPPKLGPP 146 PP P P +Y PP PP Y PP PP Sbjct: 469 PPPPPPPPPPVYSPPPPSPPPPPPPVYSPPPPPPP 503 Score = 28.3 bits (60), Expect = 3.5 Identities = 16/39 (41%), Positives = 16/39 (41%) Frame = +3 Query: 30 PNQNYERPPXPLNKPKTIYGPPKVYGPPKSYGPPKLGPP 146 P Y PP P P PP VY PP PP PP Sbjct: 445 PPPVYSPPPPPPPPP-----PPPVYSPPPPPPPPPPPPP 478 Score = 28.3 bits (60), Expect = 3.5 Identities = 14/36 (38%), Positives = 15/36 (41%), Gaps = 4/36 (11%) Frame = +3 Query: 51 PPXPLNKPKTIYGPPKVYGPPKS----YGPPKLGPP 146 PP P P +Y PP PP Y PP PP Sbjct: 453 PPPPPPPPPPVYSPPPPPPPPPPPPPVYSPPPPSPP 488 Score = 28.3 bits (60), Expect = 3.5 Identities = 13/32 (40%), Positives = 14/32 (43%) Frame = +3 Query: 51 PPXPLNKPKTIYGPPKVYGPPKSYGPPKLGPP 146 PP P P +Y PP PP PP PP Sbjct: 484 PPSPPPPPPPVYSPPP--PPPPPPPPPVYSPP 513 >At3g20850.1 68416.m02636 proline-rich family protein contains proline-rich extensin domains, INTERPRO:IPR002965 Length = 134 Score = 32.3 bits (70), Expect = 0.22 Identities = 13/31 (41%), Positives = 16/31 (51%) Frame = +3 Query: 30 PNQNYERPPXPLNKPKTIYGPPKVYGPPKSY 122 P Y PP L P IY PP + PP++Y Sbjct: 72 PPTPYYSPPADLPPPTPIYPPPVAFPPPQAY 102 Score = 29.5 bits (63), Expect = 1.5 Identities = 17/41 (41%), Positives = 17/41 (41%), Gaps = 2/41 (4%) Frame = +3 Query: 30 PNQNYERPPXPLNKPKT-IYGPPKVYGPPKS-YGPPKLGPP 146 P Y PP L P T Y PP PP Y PP PP Sbjct: 58 PTPVYSPPPADLPPPPTPYYSPPADLPPPTPIYPPPVAFPP 98 Score = 27.5 bits (58), Expect = 6.2 Identities = 12/36 (33%), Positives = 17/36 (47%), Gaps = 1/36 (2%) Frame = +3 Query: 30 PNQNYERPPXPLNKPKTIYGPPK-VYGPPKSYGPPK 134 P + PP P P PP +Y PP ++ PP+ Sbjct: 65 PPADLPPPPTPYYSPPADLPPPTPIYPPPVAFPPPQ 100 >At2g27380.1 68415.m03302 proline-rich family protein contains proline-rich extensin domains, INTERPRO:IPR002965 Length = 761 Score = 31.9 bits (69), Expect = 0.29 Identities = 15/34 (44%), Positives = 17/34 (50%) Frame = +3 Query: 45 ERPPXPLNKPKTIYGPPKVYGPPKSYGPPKLGPP 146 ++PP P P IY PP P SY PP PP Sbjct: 122 QKPPTPTYSPP-IYPPPIQKPPTPSYSPPVKPPP 154 Score = 31.1 bits (67), Expect = 0.50 Identities = 17/43 (39%), Positives = 19/43 (44%), Gaps = 4/43 (9%) Frame = +3 Query: 30 PNQNYERPPXPLNKPKTIYGPPKVYGP----PKSYGPPKLGPP 146 P Y PP P IY PP +Y P P +Y PP PP Sbjct: 45 PPPIYGAPPSYTTPPPPIYSPP-IYPPPIQKPPTYSPPIYPPP 86 Score = 30.7 bits (66), Expect = 0.66 Identities = 14/34 (41%), Positives = 17/34 (50%) Frame = +3 Query: 45 ERPPXPLNKPKTIYGPPKVYGPPKSYGPPKLGPP 146 ++PP P P IY PP P +Y PP PP Sbjct: 105 QKPPTPTYSPP-IYPPPIQKPPTPTYSPPIYPPP 137 Score = 30.3 bits (65), Expect = 0.88 Identities = 20/47 (42%), Positives = 23/47 (48%), Gaps = 8/47 (17%) Frame = +3 Query: 30 PNQNYERP--PXPLNKPKT-IYG----PPKVYGPPKS-YGPPKLGPP 146 P Y P P P++KP T IY PP V+ PP Y PP PP Sbjct: 226 PTPTYSPPVKPPPVHKPPTPIYSPPIKPPPVHKPPTPIYSPPVKPPP 272 Score = 29.9 bits (64), Expect = 1.2 Identities = 20/47 (42%), Positives = 24/47 (51%), Gaps = 8/47 (17%) Frame = +3 Query: 30 PNQNYERP--PXPLNKPKT-IYG----PPKVYGPP-KSYGPPKLGPP 146 P Y P P P++KP T IY PP V+ PP +Y PP PP Sbjct: 192 PTPIYSPPIKPPPVHKPPTPIYSPPIKPPPVHKPPTPTYSPPVKPPP 238 Score = 29.5 bits (63), Expect = 1.5 Identities = 18/43 (41%), Positives = 20/43 (46%), Gaps = 4/43 (9%) Frame = +3 Query: 30 PNQNYERP--PXPLNKPKT-IYGPPKVYGPPKSYGP-PKLGPP 146 P Y P P P+ KP T Y PP +Y PP P P PP Sbjct: 91 PTPTYSPPIYPPPIQKPPTPTYSPP-IYPPPIQKPPTPTYSPP 132 Score = 29.5 bits (63), Expect = 1.5 Identities = 18/46 (39%), Positives = 20/46 (43%), Gaps = 7/46 (15%) Frame = +3 Query: 30 PNQNYERP--PXPLNKPKTIYG----PPKVYGPPKS-YGPPKLGPP 146 P Y P P P+ P IY PP V+ PP Y PP PP Sbjct: 328 PTPTYSPPIKPPPVKPPTPIYSPPVKPPPVHKPPTPIYSPPVKPPP 373 Score = 29.5 bits (63), Expect = 1.5 Identities = 20/47 (42%), Positives = 24/47 (51%), Gaps = 8/47 (17%) Frame = +3 Query: 30 PNQNYERP--PXPLNKPKT-IYG----PPKVYGPP-KSYGPPKLGPP 146 P Y P P P++KP T IY PP V+ PP +Y PP PP Sbjct: 428 PTPIYSPPVKPPPVHKPPTPIYSPPVKPPPVHKPPTPTYSPPIKPPP 474 Score = 29.1 bits (62), Expect = 2.0 Identities = 15/35 (42%), Positives = 17/35 (48%), Gaps = 4/35 (11%) Frame = +3 Query: 54 PXPLNKPKT----IYGPPKVYGPPKSYGPPKLGPP 146 P P+ KP T IY PP P +Y PP PP Sbjct: 69 PPPIQKPPTYSPPIYPPPIQKPPTPTYSPPIYPPP 103 Score = 29.1 bits (62), Expect = 2.0 Identities = 20/47 (42%), Positives = 23/47 (48%), Gaps = 8/47 (17%) Frame = +3 Query: 30 PNQNYERP--PXPLNKPKT-IYGPP----KVYGPPKS-YGPPKLGPP 146 P Y P P P++KP T IY PP V+ PP Y PP PP Sbjct: 344 PTPIYSPPVKPPPVHKPPTPIYSPPVKPPPVHKPPTPIYSPPVKPPP 390 Score = 29.1 bits (62), Expect = 2.0 Identities = 19/47 (40%), Positives = 23/47 (48%), Gaps = 8/47 (17%) Frame = +3 Query: 30 PNQNYERP--PXPLNKPKT-IYGPP----KVYGPP-KSYGPPKLGPP 146 P Y P P P++KP T Y PP V+ PP +Y PP PP Sbjct: 545 PTPTYSPPIKPPPIHKPPTPTYSPPIKPPPVHKPPTPTYSPPIKPPP 591 Score = 28.7 bits (61), Expect = 2.7 Identities = 19/46 (41%), Positives = 22/46 (47%), Gaps = 7/46 (15%) Frame = +3 Query: 30 PNQNYERP--PXPLNKPKT-IYGP---PKVYGPPKS-YGPPKLGPP 146 P Y P P P++KP T Y P P V+ PP Y PP PP Sbjct: 159 PTPTYSPPIKPPPVHKPPTPTYSPPIKPPVHKPPTPIYSPPIKPPP 204 Score = 28.7 bits (61), Expect = 2.7 Identities = 19/47 (40%), Positives = 23/47 (48%), Gaps = 8/47 (17%) Frame = +3 Query: 30 PNQNYERP--PXPLNKPKT-IYG----PPKVYGPP-KSYGPPKLGPP 146 P Y P P P++KP T Y PP V+ PP +Y PP PP Sbjct: 562 PTPTYSPPIKPPPVHKPPTPTYSPPIKPPPVHKPPTPTYSPPIKPPP 608 Score = 28.7 bits (61), Expect = 2.7 Identities = 19/47 (40%), Positives = 23/47 (48%), Gaps = 8/47 (17%) Frame = +3 Query: 30 PNQNYERP--PXPLNKPKT-IYG----PPKVYGPP-KSYGPPKLGPP 146 P Y P P P++KP T Y PP V+ PP +Y PP PP Sbjct: 579 PTPTYSPPIKPPPVHKPPTPTYSPPIKPPPVHKPPTPTYSPPIKPPP 625 Score = 28.7 bits (61), Expect = 2.7 Identities = 19/47 (40%), Positives = 23/47 (48%), Gaps = 8/47 (17%) Frame = +3 Query: 30 PNQNYERP--PXPLNKPKT-IYG----PPKVYGPP-KSYGPPKLGPP 146 P Y P P P++KP T Y PP V+ PP +Y PP PP Sbjct: 596 PTPTYSPPIKPPPVHKPPTPTYSPPIKPPPVHKPPTPTYSPPIKPPP 642 Score = 28.7 bits (61), Expect = 2.7 Identities = 19/47 (40%), Positives = 23/47 (48%), Gaps = 8/47 (17%) Frame = +3 Query: 30 PNQNYERP--PXPLNKPKT-IYG----PPKVYGPP-KSYGPPKLGPP 146 P Y P P P++KP T Y PP V+ PP +Y PP PP Sbjct: 613 PTPTYSPPIKPPPVHKPPTPTYSPPIKPPPVHKPPTPTYSPPIKPPP 659 Score = 28.3 bits (60), Expect = 3.5 Identities = 19/46 (41%), Positives = 19/46 (41%), Gaps = 7/46 (15%) Frame = +3 Query: 30 PNQNYERP--PXPLNKPKT-IYGP----PKVYGPPKSYGPPKLGPP 146 P Y P P PL KP T Y P P V P Y PP PP Sbjct: 395 PTPTYSPPIKPPPLQKPPTPTYSPPIKLPPVKPPTPIYSPPVKPPP 440 Score = 28.3 bits (60), Expect = 3.5 Identities = 18/46 (39%), Positives = 20/46 (43%), Gaps = 7/46 (15%) Frame = +3 Query: 30 PNQNYERP--PXPLNKPKT-IYG----PPKVYGPPKSYGPPKLGPP 146 P Y P P P+ KP T Y PP V P +Y PP PP Sbjct: 495 PTPTYSPPVKPPPIQKPPTPTYSPPIKPPPVKPPTPTYSPPIKPPP 540 Score = 27.9 bits (59), Expect = 4.7 Identities = 20/47 (42%), Positives = 22/47 (46%), Gaps = 8/47 (17%) Frame = +3 Query: 30 PNQNYERP--PXPLNKPKT-IYG----PPKVYGPPKS-YGPPKLGPP 146 P Y P P P++KP T IY PP V PP Y PP PP Sbjct: 243 PTPIYSPPIKPPPVHKPPTPIYSPPVKPPPVQTPPTPIYSPPVKPPP 289 Score = 27.9 bits (59), Expect = 4.7 Identities = 15/38 (39%), Positives = 18/38 (47%), Gaps = 5/38 (13%) Frame = +3 Query: 48 RPPXPLNKPKTIYG----PPKVYGPP-KSYGPPKLGPP 146 +PP P IY PP V+ PP +Y PP PP Sbjct: 269 KPPPVQTPPTPIYSPPVKPPPVHKPPTPTYSPPVKSPP 306 Score = 27.9 bits (59), Expect = 4.7 Identities = 19/47 (40%), Positives = 23/47 (48%), Gaps = 8/47 (17%) Frame = +3 Query: 30 PNQNYERP--PXPLNKPKT-IYG----PPKVYGPP-KSYGPPKLGPP 146 P Y P P P++KP T IY PP + PP +Y PP PP Sbjct: 361 PTPIYSPPVKPPPVHKPPTPIYSPPVKPPPIQKPPTPTYSPPIKPPP 407 Score = 27.9 bits (59), Expect = 4.7 Identities = 17/46 (36%), Positives = 20/46 (43%), Gaps = 7/46 (15%) Frame = +3 Query: 30 PNQNYERP--PXPLNKPKTIYGPP----KVYGPP-KSYGPPKLGPP 146 P Y P P P+ P Y PP V+ PP +Y PP PP Sbjct: 512 PTPTYSPPIKPPPVKPPTPTYSPPIKPPPVHKPPTPTYSPPIKPPP 557 Score = 27.9 bits (59), Expect = 4.7 Identities = 19/47 (40%), Positives = 22/47 (46%), Gaps = 8/47 (17%) Frame = +3 Query: 30 PNQNYERP--PXPLNKPKT-IYG----PPKVYGPP-KSYGPPKLGPP 146 P Y P P P++KP T Y PP V PP +Y PP PP Sbjct: 630 PTPTYSPPIKPPPVHKPPTPTYSPPIKPPPVQKPPTPTYSPPVKPPP 676 Score = 27.5 bits (58), Expect = 6.2 Identities = 15/33 (45%), Positives = 17/33 (51%), Gaps = 2/33 (6%) Frame = +3 Query: 54 PXPLNKPKT-IYGPPKVYGPPKSYGP-PKLGPP 146 P P+ KP T Y PP +Y PP P P PP Sbjct: 84 PPPIQKPPTPTYSPP-IYPPPIQKPPTPTYSPP 115 Score = 27.5 bits (58), Expect = 6.2 Identities = 18/46 (39%), Positives = 21/46 (45%), Gaps = 7/46 (15%) Frame = +3 Query: 30 PNQNYERP--PXPLNKPKT-IYG----PPKVYGPPKSYGPPKLGPP 146 P Y P P P++KP T Y PP V P +Y PP PP Sbjct: 445 PTPIYSPPVKPPPVHKPPTPTYSPPIKPPPVKPPTPTYSPPVQPPP 490 Score = 27.5 bits (58), Expect = 6.2 Identities = 12/34 (35%), Positives = 16/34 (47%) Frame = +3 Query: 45 ERPPXPLNKPKTIYGPPKVYGPPKSYGPPKLGPP 146 ++PP P P + PP P +Y PP PP Sbjct: 661 QKPPTPTYSPP-VKPPPVQLPPTPTYSPPVKPPP 693 Score = 27.1 bits (57), Expect = 8.2 Identities = 18/46 (39%), Positives = 19/46 (41%), Gaps = 7/46 (15%) Frame = +3 Query: 30 PNQNYERP--PXPLNKPKT-IYG----PPKVYGPPKSYGPPKLGPP 146 P Y P P P+ KP T Y PP V P Y PP PP Sbjct: 311 PTPTYSPPIKPPPVQKPPTPTYSPPIKPPPVKPPTPIYSPPVKPPP 356 Score = 27.1 bits (57), Expect = 8.2 Identities = 17/46 (36%), Positives = 19/46 (41%), Gaps = 7/46 (15%) Frame = +3 Query: 30 PNQNYERP--PXPLNKPKTIYG----PPKVYGPP-KSYGPPKLGPP 146 P Y P P P+ P Y PP V PP +Y PP PP Sbjct: 462 PTPTYSPPIKPPPVKPPTPTYSPPVQPPPVQKPPTPTYSPPVKPPP 507 >At4g33970.1 68417.m04820 leucine-rich repeat family protein / extensin family protein similar to extensin-like protein [Lycopersicon esculentum] gi|5917664|gb|AAD55979; contains leucine-rich repeats, Pfam:PF00560; contains proline rich extensin domains, INTERPRO:IPR002965 Length = 699 Score = 31.5 bits (68), Expect = 0.38 Identities = 13/34 (38%), Positives = 17/34 (50%) Frame = +3 Query: 51 PPXPLNKPKTIYGPPKVYGPPKSYGPPKLGPPKL 152 PP + P ++ PP PP Y PP PPK+ Sbjct: 615 PPPVYSPPPPVFSPPPSQSPPVVYSPPP-RPPKI 647 Score = 29.9 bits (64), Expect = 1.2 Identities = 14/33 (42%), Positives = 16/33 (48%), Gaps = 1/33 (3%) Frame = +3 Query: 51 PPXPLNK-PKTIYGPPKVYGPPKSYGPPKLGPP 146 PP P+N P +Y PP P S PP PP Sbjct: 519 PPAPVNSPPPPVYSPPPPPPPVHSPPPPVHSPP 551 Score = 29.1 bits (62), Expect = 2.0 Identities = 14/36 (38%), Positives = 19/36 (52%), Gaps = 4/36 (11%) Frame = +3 Query: 51 PPXPLNKPKT---IYGPPK-VYGPPKSYGPPKLGPP 146 PP P++ P +Y PP V+ PP S PP + P Sbjct: 605 PPPPVHSPPPPPPVYSPPPPVFSPPPSQSPPVVYSP 640 Score = 27.5 bits (58), Expect = 6.2 Identities = 13/34 (38%), Positives = 16/34 (47%), Gaps = 2/34 (5%) Frame = +3 Query: 51 PPXPLNKPKT--IYGPPKVYGPPKSYGPPKLGPP 146 PP P++ P +Y PP P S PP PP Sbjct: 543 PPPPVHSPPPPPVYSPPPPPPPVHSPPPPVFSPP 576 >At1g53260.1 68414.m06035 hypothetical protein low similarity to SP|Q38732 DAG protein, chloroplast precursor {Antirrhinum majus} Length = 358 Score = 31.1 bits (67), Expect = 0.50 Identities = 19/45 (42%), Positives = 20/45 (44%), Gaps = 7/45 (15%) Frame = +3 Query: 33 NQNYERPPXPLNKPKTIYGPP------KVYGPPKS-YGPPKLGPP 146 NQNY PP P N + GPP GPP S G GPP Sbjct: 225 NQNYRGPPPPPNMNQNYQGPPAPNMNQNYQGPPPSNMGQNYQGPP 269 >At4g38770.1 68417.m05490 proline-rich family protein (PRP4) similar to proline-rich protein [Arabidopsis thaliana] gi|6782442|gb|AAF28388; contains proline-rich extensin domains, INTERPRO:IPR002965 Length = 448 Score = 30.7 bits (66), Expect = 0.66 Identities = 16/43 (37%), Positives = 23/43 (53%), Gaps = 2/43 (4%) Frame = +3 Query: 30 PNQNYERPPXPLNKP--KTIYGPPKVYGPPKSYGPPKLGPPKL 152 P + + PP P++KP K + PPK+ PP P PPK+ Sbjct: 321 PPKKVDPPPVPVHKPPPKIVIPPPKIEHPPPV--PVYKPPPKI 361 Score = 30.3 bits (65), Expect = 0.88 Identities = 19/56 (33%), Positives = 28/56 (50%), Gaps = 6/56 (10%) Frame = +3 Query: 3 LHEFGTRVFPNQNYERPPXPLNKPKTIYG-PPKVYGPPK---SYGPPK--LGPPKL 152 +H+ + P + + PP P++KP T PPK PP PPK + PPK+ Sbjct: 291 VHKLPKKPCPPKKVDPPPVPVHKPPTKKPCPPKKVDPPPVPVHKPPPKIVIPPPKI 346 >At3g49840.1 68416.m05449 proline-rich family protein contains proline rich extensin domains, INTERPRO:IPR002965 Length = 606 Score = 30.7 bits (66), Expect = 0.66 Identities = 14/36 (38%), Positives = 18/36 (50%) Frame = +3 Query: 39 NYERPPXPLNKPKTIYGPPKVYGPPKSYGPPKLGPP 146 +Y+ P P++ P PPK PP Y PP PP Sbjct: 484 SYQDPQHPVSAPPPQGYPPKEGYPPAGYPPPAGYPP 519 Score = 27.5 bits (58), Expect = 6.2 Identities = 14/35 (40%), Positives = 15/35 (42%) Frame = +3 Query: 30 PNQNYERPPXPLNKPKTIYGPPKVYGPPKSYGPPK 134 P PP PK Y PP Y PP Y PP+ Sbjct: 488 PQHPVSAPPPQGYPPKEGY-PPAGYPPPAGYPPPQ 521 >At4g36870.1 68417.m05228 BEL1-like homeobox 2 protein (BLH2) Length = 638 Score = 30.3 bits (65), Expect = 0.88 Identities = 14/30 (46%), Positives = 16/30 (53%), Gaps = 2/30 (6%) Frame = +1 Query: 178 MALPSPSRRTVHHLKYQNS*RNHS--HRNH 261 M LPSPS T HH Y N H H++H Sbjct: 172 MLLPSPSTNTTHHQNYTNHMSMHQLPHQHH 201 >At5g40490.1 68418.m04910 RNA recognition motif (RRM)-containing protein ribonucleoprotein, Xenopus laevis, PIR:S40778; contains InterPro entry IPR000504: RNA-binding region RNP-1 (RNA recognition motif) (RRM) Length = 423 Score = 29.9 bits (64), Expect = 1.2 Identities = 16/43 (37%), Positives = 22/43 (51%), Gaps = 3/43 (6%) Frame = +3 Query: 378 TVTTVETNIG---TNFGGDFGVNFADSHGVDFGGTFGSNFDSG 497 +VTT G +NFGG +G + HG +GG G + SG Sbjct: 213 SVTTPSKRFGDSRSNFGGGYGDGYGGGHGGGYGGP-GGPYKSG 254 >At3g14010.1 68416.m01769 hydroxyproline-rich glycoprotein family protein similar to Mrs16p (GI:2737884) [Saccharomyces cerevisiae]; weak similarity to ataxin-2 related protein (GI:1679686) [Homo sapiens] Length = 595 Score = 29.9 bits (64), Expect = 1.2 Identities = 12/27 (44%), Positives = 15/27 (55%) Frame = +3 Query: 30 PNQNYERPPXPLNKPKTIYGPPKVYGP 110 P NY PP P N+P+ +Y P Y P Sbjct: 519 PPVNYGLPPYPGNQPQMMYHPQAYYHP 545 >At2g15880.1 68415.m01820 leucine-rich repeat family protein / extensin family protein similar to extensin-like protein [Lycopersicon esculentum] gi|5917664|gb|AAD55979; contains leucine-rich repeats, Pfam:PF00560; contains proline rich extensin domains, INTERPRO:IPR002965 Length = 727 Score = 29.9 bits (64), Expect = 1.2 Identities = 17/45 (37%), Positives = 21/45 (46%), Gaps = 4/45 (8%) Frame = +3 Query: 30 PNQNYERPPXPLNKPKTIYGPP----KVYGPPKSYGPPKLGPPKL 152 P + PP + P +Y PP K PP Y PP L PPK+ Sbjct: 633 PPPVHSPPPPVYSPPPPVYSPPPPPVKSPPPPPVYSPPLL-PPKM 676 Score = 27.1 bits (57), Expect = 8.2 Identities = 15/41 (36%), Positives = 20/41 (48%), Gaps = 3/41 (7%) Frame = +3 Query: 30 PNQNYERPPXPLNKPKT-IYGPPK-VYGPPKS-YGPPKLGP 143 P Y PP P++ P ++ PP V+ PP Y PP P Sbjct: 581 PPPVYSPPPPPVHSPPPPVHSPPPPVHSPPPPVYSPPPPPP 621 >At1g62500.1 68414.m07052 protease inhibitor/seed storage/lipid transfer protein (LTP) family protein similar to auxin down regulated GB:X69640 GI:296442 from [Glycine max]; contains Pfam profile PF00234: Protease inhibitor/seed storage/LTP family Length = 297 Score = 29.9 bits (64), Expect = 1.2 Identities = 14/32 (43%), Positives = 15/32 (46%) Frame = +3 Query: 51 PPXPLNKPKTIYGPPKVYGPPKSYGPPKLGPP 146 PP + P I PP VY PP PP PP Sbjct: 95 PPVVVRPPPIIRPPPVVYPPPIVRPPPITRPP 126 Score = 29.5 bits (63), Expect = 1.5 Identities = 13/33 (39%), Positives = 17/33 (51%) Frame = +3 Query: 48 RPPXPLNKPKTIYGPPKVYGPPKSYGPPKLGPP 146 RPP + P +Y PP + PP PP + PP Sbjct: 100 RPPPIIRPPPVVY-PPPIVRPPPITRPPIIIPP 131 Score = 28.7 bits (61), Expect = 2.7 Identities = 13/35 (37%), Positives = 17/35 (48%) Frame = +3 Query: 48 RPPXPLNKPKTIYGPPKVYGPPKSYGPPKLGPPKL 152 RPP + +P I PP V PP PP + P + Sbjct: 93 RPPPVVVRPPPIIRPPPVVYPPPIVRPPPITRPPI 127 Score = 28.3 bits (60), Expect = 3.5 Identities = 12/34 (35%), Positives = 16/34 (47%) Frame = +3 Query: 51 PPXPLNKPKTIYGPPKVYGPPKSYGPPKLGPPKL 152 PP P + PP + PP Y PP + PP + Sbjct: 89 PPVVRPPPVVVRPPPIIRPPPVVYPPPIVRPPPI 122 Score = 27.5 bits (58), Expect = 6.2 Identities = 12/22 (54%), Positives = 12/22 (54%) Frame = +3 Query: 81 IYGPPKVYGPPKSYGPPKLGPP 146 I PP V PP S G P GPP Sbjct: 177 IINPPPVTVPPPSSGYPPYGPP 198 >At1g12040.1 68414.m01390 leucine-rich repeat family protein / extensin family protein (LRX1) similar to extensin-like protein [Lycopersicon esculentum] gi|5917664|gb|AAD55979; contains leucine-rich repeats, Pfam:PF00560; contains proline rich extensin domains, INTERPRO:IPR002965 Length = 744 Score = 29.9 bits (64), Expect = 1.2 Identities = 14/34 (41%), Positives = 16/34 (47%), Gaps = 3/34 (8%) Frame = +3 Query: 51 PPXPLNKPKTIYGPPK---VYGPPKSYGPPKLGP 143 PP P+ P PP VY PP +Y PP P Sbjct: 569 PPSPVYYPPVTNSPPPPSPVYYPPVTYSPPPPSP 602 Score = 27.9 bits (59), Expect = 4.7 Identities = 15/41 (36%), Positives = 17/41 (41%), Gaps = 3/41 (7%) Frame = +3 Query: 30 PNQNYERPPXPLNKPKTIYGPP---KVYGPPKSYGPPKLGP 143 P N PP P+ P Y PP VY P + PP P Sbjct: 577 PVTNSPPPPSPVYYPPVTYSPPPPSPVYYPQVTPSPPPPSP 617 >At3g22800.1 68416.m02874 leucine-rich repeat family protein / extensin family protein similar to extensin-like protein [Lycsimilar to extensin-like protein [Lycopersicon esculentum] gi|5917664|gb|AAD55979; contains leucine-rich repeats, Pfam:PF00560; contains proline rich extensin domains, INTERPRO:IPR002965 Length = 470 Score = 29.5 bits (63), Expect = 1.5 Identities = 16/35 (45%), Positives = 19/35 (54%), Gaps = 3/35 (8%) Frame = +3 Query: 51 PPXPLNKPKTIYGPPK---VYGPPKSYGPPKLGPP 146 PP P + P +Y PP VY PP S PP + PP Sbjct: 414 PPPPPSPPPYVYPPPPPPYVYPPPPS--PPYVYPP 446 >At2g48030.1 68415.m06012 endonuclease/exonuclease/phosphatase family protein contains Pfam profile PF03372: Endonuclease/Exonuclease/phosphatase family Length = 438 Score = 28.7 bits (61), Expect = 2.7 Identities = 14/38 (36%), Positives = 22/38 (57%), Gaps = 2/38 (5%) Frame = +1 Query: 151 SLMDLLKRRMALPSPSRRTV--HHLKYQNS*RNHSHRN 258 +L+ L+RR+ P +R +V HHL +S H H+N Sbjct: 3 NLIAFLRRRLRRPRKARISVNHHHLSVDSSPETHHHQN 40 >At1g31750.1 68414.m03895 proline-rich family protein contains proline rich extensin domains, INTERPRO:IPR002965 Length = 176 Score = 28.7 bits (61), Expect = 2.7 Identities = 16/39 (41%), Positives = 17/39 (43%) Frame = +3 Query: 27 FPNQNYERPPXPLNKPKTIYGPPKVYGPPKSYGPPKLGP 143 +P Q Y PP P P Y PP PP Y P GP Sbjct: 43 YPPQGY--PPPPHGYPPAAYPPPPGAYPPAGYPGPS-GP 78 Score = 27.1 bits (57), Expect = 8.2 Identities = 15/40 (37%), Positives = 17/40 (42%) Frame = +3 Query: 27 FPNQNYERPPXPLNKPKTIYGPPKVYGPPKSYGPPKLGPP 146 +P Y PP P Y PP+ Y PP PP PP Sbjct: 24 YPPGAYPPPPQGAYPPPGGY-PPQGYPPPPHGYPPAAYPP 62 >At5g23950.1 68418.m02812 C2 domain-containing protein similar to cold-regulated gene SRC2 [Glycine max] GI:2055230; contains Pfam profile PF00168: C2 domain Length = 219 Score = 28.3 bits (60), Expect = 3.5 Identities = 18/64 (28%), Positives = 27/64 (42%), Gaps = 2/64 (3%) Frame = +3 Query: 315 YGAPLLNVQNI--PLELPPIQLPTVTTVETNIGTNFGGDFGVNFADSHGVDFGGTFGSNF 488 +G P + + P P +L TV G+N+ +G +A G FGG G+ Sbjct: 107 FGVPFMKTLKLKRPSGRPQGKLDVTVTVRETPGSNYALPYGDPYAPEKGSKFGG-MGTGL 165 Query: 489 DSGA 500 GA Sbjct: 166 AVGA 169 >At4g08380.1 68417.m01384 proline-rich extensin-like family protein contains proline-rich extensin domains, INTERPRO:IPR002965 Length = 437 Score = 28.3 bits (60), Expect = 3.5 Identities = 17/45 (37%), Positives = 19/45 (42%), Gaps = 6/45 (13%) Frame = +3 Query: 30 PNQNYERPPXPLNKPKT---IYGPPK-VYG--PPKSYGPPKLGPP 146 P Y PP + P +Y PP VY PP Y PP PP Sbjct: 378 PPYTYSPPPYAYSPPPPCPDVYKPPPYVYSSPPPYVYNPPPSSPP 422 >At3g57410.1 68416.m06391 villin 3 (VLN3) nearly identical to villin 3 (VLN3) [Arabidopsis thaliana] GI:3415117 Length = 965 Score = 28.3 bits (60), Expect = 3.5 Identities = 16/50 (32%), Positives = 21/50 (42%) Frame = -2 Query: 463 KSTPWLSAKFTPKSPPKFVPMFVSTVVTVGSCIGGSSKGMFWTFNNGAPY 314 K P + F K PP+FV +F VV G G M ++G Y Sbjct: 466 KGRPVQARIFEGKEPPQFVALFQHMVVLKGGLSSGYKNSMTEKGSSGETY 515 >At3g44340.1 68416.m04764 sec23/sec24 transport family protein contains Pfam domains PF04811: Sec23/Sec24 trunk domain, PF04815: Sec23/Sec24 helical domain and PF04810: Sec23/Sec24 zinc finger Length = 1096 Score = 28.3 bits (60), Expect = 3.5 Identities = 14/41 (34%), Positives = 21/41 (51%), Gaps = 1/41 (2%) Frame = +3 Query: 27 FPNQNYERP-PXPLNKPKTIYGPPKVYGPPKSYGPPKLGPP 146 FP Q ++P P P+ +P GPP + GPP++ P Sbjct: 70 FPQQQQQQPRPSPMARP----GPPPPAAMARPGGPPQVSQP 106 >At1g54970.1 68414.m06278 proline-rich family protein similar to proline-rich protein GI:170048 from [Glycine max] Length = 335 Score = 28.3 bits (60), Expect = 3.5 Identities = 12/32 (37%), Positives = 16/32 (50%), Gaps = 2/32 (6%) Frame = +3 Query: 42 YERP--PXPLNKPKTIYGPPKVYGPPKSYGPP 131 Y +P P P+ K Y PP + P +Y PP Sbjct: 171 YTKPTLPPPVYKKSPSYSPPPPFAPKPTYTPP 202 >At1g49490.1 68414.m05547 leucine-rich repeat family protein / extensin family protein contains similarity to disease resistance protein GI:3894383 from [Lycopersicon esculentum]; contains leucine-rich repeats, Pfam:PF00560; contains proline rich extensin domains, INTERPRO:IPR002965 Length = 847 Score = 28.3 bits (60), Expect = 3.5 Identities = 14/39 (35%), Positives = 17/39 (43%) Frame = +3 Query: 30 PNQNYERPPXPLNKPKTIYGPPKVYGPPKSYGPPKLGPP 146 P + PP P+ P PP V+ PP PP PP Sbjct: 568 PPPHVYSPPPPVASPPPPSPPPPVHSPPP---PPVFSPP 603 Score = 27.9 bits (59), Expect = 4.7 Identities = 13/42 (30%), Positives = 20/42 (47%), Gaps = 3/42 (7%) Frame = +3 Query: 30 PNQNYERPPXPLNKPKTIYG-PPKVYGPPKSY--GPPKLGPP 146 P+ Y PP + P +Y PP + PP ++ P +G P Sbjct: 612 PSPVYSPPPPSHSPPPPVYSPPPPTFSPPPTHNTNQPPMGAP 653 >At1g27750.1 68414.m03391 ubiquitin system component Cue domain-containing protein very low similarity to ASC-1 complex subunit P100 [Homo sapiens] GI:12061187; contains Pfam profile PF02845: CUE domain Length = 1973 Score = 28.3 bits (60), Expect = 3.5 Identities = 14/39 (35%), Positives = 19/39 (48%) Frame = +3 Query: 30 PNQNYERPPXPLNKPKTIYGPPKVYGPPKSYGPPKLGPP 146 P Q +PP P P+ + PP+ PP + P L PP Sbjct: 862 PLQPQSQPPEP--PPEMMPPPPQALPPPLPHSHPPLVPP 898 >At5g48920.1 68418.m06052 hydroxyproline-rich glycoprotein family protein contains proline-rich extensin domains, INTERPRO:IPR002965 Length = 205 Score = 27.9 bits (59), Expect = 4.7 Identities = 11/32 (34%), Positives = 16/32 (50%) Frame = +3 Query: 51 PPXPLNKPKTIYGPPKVYGPPKSYGPPKLGPP 146 PP ++ P + PP + PP + PP PP Sbjct: 27 PPSHISPPPPPFSPPH-HPPPPHFSPPHQPPP 57 Score = 27.1 bits (57), Expect = 8.2 Identities = 13/38 (34%), Positives = 19/38 (50%), Gaps = 2/38 (5%) Frame = +3 Query: 39 NYERP-PXPLNKPKT-IYGPPKVYGPPKSYGPPKLGPP 146 +++ P P P+ P + I PP + PP PP PP Sbjct: 15 SHQHPLPSPVPPPPSHISPPPPPFSPPHHPPPPHFSPP 52 >At5g21160.1 68418.m02528 La domain-containing protein / proline-rich family protein contains proline-rich extensin domains, INTERPRO:IPR002965, PF05383: La domain Length = 826 Score = 27.9 bits (59), Expect = 4.7 Identities = 19/44 (43%), Positives = 21/44 (47%), Gaps = 2/44 (4%) Frame = +3 Query: 27 FPNQNYERPPXPLNKPKTIYGP-PKVYGP-PKSYGPPKLGPPKL 152 FP Y P P P I GP P + P P + GPP L P KL Sbjct: 236 FPGPVYYLPGPP---PGAIRGPYPPRFAPYPVNQGPPILSPEKL 276 >At4g33660.1 68417.m04781 expressed protein Length = 76 Score = 27.9 bits (59), Expect = 4.7 Identities = 14/31 (45%), Positives = 15/31 (48%) Frame = +3 Query: 54 PXPLNKPKTIYGPPKVYGPPKSYGPPKLGPP 146 P P N P+ GPP G P Y PP PP Sbjct: 11 PAPGNYPQ---GPPPPVGVPPQYYPPPPPPP 38 >At3g22120.1 68416.m02792 protease inhibitor/seed storage/lipid transfer protein (LTP) family protein similar to SP|Q00451|PRF1_LYCES 36.4 kDa proline-rich protein Lycopersicon esculentum, proline-rich cell wall protein [Medicago sativa] GI:3818416; contains Pfam profile PF00234 Protease inhibitor/seed storage/LTP family Length = 334 Score = 27.9 bits (59), Expect = 4.7 Identities = 13/33 (39%), Positives = 14/33 (42%) Frame = +3 Query: 48 RPPXPLNKPKTIYGPPKVYGPPKSYGPPKLGPP 146 +PP KP T PP PP PP PP Sbjct: 133 KPPPSTPKPPTTKPPPSTPKPPHHKPPPTPCPP 165 >At2g14890.2 68415.m01692 arabinogalactan-protein (AGP9) identical to gi|10880495|gb|AAG24277 Length = 176 Score = 27.9 bits (59), Expect = 4.7 Identities = 12/31 (38%), Positives = 14/31 (45%) Frame = +3 Query: 54 PXPLNKPKTIYGPPKVYGPPKSYGPPKLGPP 146 P P N P + PP PP + PP PP Sbjct: 65 PPPANPPPPVSSPPPA-SPPPATPPPVASPP 94 Score = 27.9 bits (59), Expect = 4.7 Identities = 12/31 (38%), Positives = 13/31 (41%) Frame = +3 Query: 54 PXPLNKPKTIYGPPKVYGPPKSYGPPKLGPP 146 P P P PP V PP + PP PP Sbjct: 82 PPPATPPPVASPPPPVASPPPATPPPVATPP 112 Score = 27.5 bits (58), Expect = 6.2 Identities = 11/32 (34%), Positives = 12/32 (37%) Frame = +3 Query: 51 PPXPLNKPKTIYGPPKVYGPPKSYGPPKLGPP 146 PP + P PP PP PP PP Sbjct: 52 PPVTTSPPPVTTAPPPANPPPPVSSPPPASPP 83 Score = 27.1 bits (57), Expect = 8.2 Identities = 12/32 (37%), Positives = 13/32 (40%) Frame = +3 Query: 51 PPXPLNKPKTIYGPPKVYGPPKSYGPPKLGPP 146 PP P PP V PP + PP PP Sbjct: 58 PPPVTTAPPPANPPPPVSSPPPASPPPATPPP 89 Score = 27.1 bits (57), Expect = 8.2 Identities = 12/32 (37%), Positives = 14/32 (43%) Frame = +3 Query: 51 PPXPLNKPKTIYGPPKVYGPPKSYGPPKLGPP 146 PP P++ P PP P S PP PP Sbjct: 70 PPPPVSSPPPASPPPATPPPVASPPPPVASPP 101 >At2g14890.1 68415.m01693 arabinogalactan-protein (AGP9) identical to gi|10880495|gb|AAG24277 Length = 191 Score = 27.9 bits (59), Expect = 4.7 Identities = 12/31 (38%), Positives = 14/31 (45%) Frame = +3 Query: 54 PXPLNKPKTIYGPPKVYGPPKSYGPPKLGPP 146 P P N P + PP PP + PP PP Sbjct: 65 PPPANPPPPVSSPPPA-SPPPATPPPVASPP 94 Score = 27.9 bits (59), Expect = 4.7 Identities = 12/31 (38%), Positives = 13/31 (41%) Frame = +3 Query: 54 PXPLNKPKTIYGPPKVYGPPKSYGPPKLGPP 146 P P P PP V PP + PP PP Sbjct: 82 PPPATPPPVASPPPPVASPPPATPPPVATPP 112 Score = 27.5 bits (58), Expect = 6.2 Identities = 11/32 (34%), Positives = 12/32 (37%) Frame = +3 Query: 51 PPXPLNKPKTIYGPPKVYGPPKSYGPPKLGPP 146 PP + P PP PP PP PP Sbjct: 52 PPVTTSPPPVTTAPPPANPPPPVSSPPPASPP 83 Score = 27.1 bits (57), Expect = 8.2 Identities = 12/32 (37%), Positives = 13/32 (40%) Frame = +3 Query: 51 PPXPLNKPKTIYGPPKVYGPPKSYGPPKLGPP 146 PP P PP V PP + PP PP Sbjct: 58 PPPVTTAPPPANPPPPVSSPPPASPPPATPPP 89 Score = 27.1 bits (57), Expect = 8.2 Identities = 12/32 (37%), Positives = 14/32 (43%) Frame = +3 Query: 51 PPXPLNKPKTIYGPPKVYGPPKSYGPPKLGPP 146 PP P++ P PP P S PP PP Sbjct: 70 PPPPVSSPPPASPPPATPPPVASPPPPVASPP 101 >At1g79730.1 68414.m09300 hydroxyproline-rich glycoprotein family protein contains proline-rich extensin domains, INTERPRO:IPR002965 Length = 589 Score = 27.9 bits (59), Expect = 4.7 Identities = 16/40 (40%), Positives = 20/40 (50%), Gaps = 1/40 (2%) Frame = +3 Query: 30 PNQN-YERPPXPLNKPKTIYGPPKVYGPPKSYGPPKLGPP 146 P+QN PP P + P + PP + P SY PP PP Sbjct: 15 PSQNSLAPPPPPPSLPPPVPPPPPSH-QPYSYPPPPPPPP 53 >At1g20130.1 68414.m02518 family II extracellular lipase, putative contains Pfam profile PF00657: GDSL-like Lipase/Acylhydrolase; similar to EXL3 (PMID:11431566) Length = 1006 Score = 27.9 bits (59), Expect = 4.7 Identities = 14/37 (37%), Positives = 17/37 (45%), Gaps = 3/37 (8%) Frame = +3 Query: 48 RPPXPLNKPKTIYGPPKVYGPPKSYGP---PKLGPPK 149 +PP P KP +GPP P + P P PPK Sbjct: 103 KPPAPTPKPVPPHGPPPKPAPAPTPAPSPKPAPSPPK 139 >At4g22470.1 68417.m03245 protease inhibitor/seed storage/lipid transfer protein (LTP) family protein similar to hydroxyproline-rich glycoprotein DZ-HRGP from Volvox carteri f. nagariensis GP|6523547; contains Pfam profile PF00234 Protease inhibitor/seed storage/LTP family Length = 375 Score = 27.5 bits (58), Expect = 6.2 Identities = 13/31 (41%), Positives = 16/31 (51%) Frame = +3 Query: 54 PXPLNKPKTIYGPPKVYGPPKSYGPPKLGPP 146 P PL+ P+T PP PP PP + PP Sbjct: 94 PPPLSPPQTTPPPPPAITPPP---PPAITPP 121 >At3g24480.1 68416.m03070 leucine-rich repeat family protein / extensin family protein similar to extensin-like protein [Lycopersicon esculentum] gi|5917664|gb|AAD55979; contains leucine-rich repeats, Pfam:PF00560; contains proline rich extensin domains, INTERPRO:IPR002965 Length = 494 Score = 27.5 bits (58), Expect = 6.2 Identities = 15/32 (46%), Positives = 16/32 (50%) Frame = +3 Query: 51 PPXPLNKPKTIYGPPKVYGPPKSYGPPKLGPP 146 PP P + P PP VY PP S PP PP Sbjct: 412 PPPPPSPPL----PPPVYSPPPS--PPVFSPP 437 >At3g19020.1 68416.m02415 leucine-rich repeat family protein / extensin family protein similar to extensin-like protein [Lycopersicon esculentum] gi|5917664|gb|AAD55979; contains leucine-rich repeats, Pfam:PF00560; contains proline rich extensin domains, INTERPRO:IPR002965 Length = 956 Score = 27.5 bits (58), Expect = 6.2 Identities = 14/40 (35%), Positives = 17/40 (42%) Frame = +3 Query: 30 PNQNYERPPXPLNKPKTIYGPPKVYGPPKSYGPPKLGPPK 149 P Q +P P KP++ PPK PK PPK Sbjct: 490 PKQEAPKPEQPKPKPESPKQESSKQEPPKPEESPKPEPPK 529 Score = 27.5 bits (58), Expect = 6.2 Identities = 16/41 (39%), Positives = 19/41 (46%) Frame = +3 Query: 30 PNQNYERPPXPLNKPKTIYGPPKVYGPPKSYGPPKLGPPKL 152 P + P P PK PPK PPK+ PK+G P L Sbjct: 568 PQPPKQETPKPEESPKP--QPPKQEQPPKTEA-PKMGSPPL 605 >At2g43150.1 68415.m05358 proline-rich extensin-like family protein similar to CRANTZ hydroxyproline-rich glycoprotein [Manihot esculenta] gi|7211797|gb|AAF40442; similar to extensin gi|1165322|gb|AAB53156; contains proline-rich extensin domains, INTERPRO:IPR002965 Length = 212 Score = 27.5 bits (58), Expect = 6.2 Identities = 17/48 (35%), Positives = 19/48 (39%), Gaps = 9/48 (18%) Frame = +3 Query: 30 PNQNYERPPXPLNKPKTIY----GPPKVYGPPKSY-----GPPKLGPP 146 P Y+ PP P+ P Y PP V PP Y PP PP Sbjct: 38 PPYEYKSPPPPVKSPPPPYEYKSPPPPVKSPPPPYYYHSPPPPVKSPP 85 Score = 27.5 bits (58), Expect = 6.2 Identities = 17/48 (35%), Positives = 19/48 (39%), Gaps = 9/48 (18%) Frame = +3 Query: 30 PNQNYERPPXPLNKPKTIY----GPPKVYGPPKSY-----GPPKLGPP 146 P Y+ PP P+ P Y PP V PP Y PP PP Sbjct: 54 PPYEYKSPPPPVKSPPPPYYYHSPPPPVKSPPPPYVYSSPPPPVKSPP 101 >At2g43010.2 68415.m05338 phytochrome-interacting factor 4 (PIF4) / basic helix-loop-helix protein 9 (bHLH9) / short under red-light 2 (SRL2) identical to SP|Q8W2F3 Phytochrome-interacting factor 4 (Basic helix-loop-helix protein 9) (bHLH9) (Short under red-light 2) {Arabidopsis thaliana}; supporting cDNA gi|18026965|gb|AF251694.1|AF251694 Length = 428 Score = 27.5 bits (58), Expect = 6.2 Identities = 16/49 (32%), Positives = 25/49 (51%), Gaps = 3/49 (6%) Frame = +3 Query: 9 EFGTRVFPNQN-YERPPXPLNKPKTIYGPPKVYGPPKSY--GPPKLGPP 146 +F + F + +RP KPK+ PP+V PK+ PP++ PP Sbjct: 88 DFSSHFFSTMDPLQRPTSETVKPKSSPEPPQVMVKPKACPDPPPQVMPP 136 >At2g43010.1 68415.m05337 phytochrome-interacting factor 4 (PIF4) / basic helix-loop-helix protein 9 (bHLH9) / short under red-light 2 (SRL2) identical to SP|Q8W2F3 Phytochrome-interacting factor 4 (Basic helix-loop-helix protein 9) (bHLH9) (Short under red-light 2) {Arabidopsis thaliana}; supporting cDNA gi|18026965|gb|AF251694.1|AF251694 Length = 430 Score = 27.5 bits (58), Expect = 6.2 Identities = 16/49 (32%), Positives = 25/49 (51%), Gaps = 3/49 (6%) Frame = +3 Query: 9 EFGTRVFPNQN-YERPPXPLNKPKTIYGPPKVYGPPKSY--GPPKLGPP 146 +F + F + +RP KPK+ PP+V PK+ PP++ PP Sbjct: 88 DFSSHFFSTMDPLQRPTSETVKPKSSPEPPQVMVKPKACPDPPPQVMPP 136 >At2g20850.1 68415.m02457 leucine-rich repeat protein kinase, putative contains Pfam domains PF00560: Leucine Rich Repeat and PF00069: Protein kinase domain Length = 772 Score = 27.5 bits (58), Expect = 6.2 Identities = 9/28 (32%), Positives = 15/28 (53%) Frame = +3 Query: 12 FGTRVFPNQNYERPPXPLNKPKTIYGPP 95 F + P+ + E PP P + + +GPP Sbjct: 246 FNVTIAPSPSPETPPSPTSPKRPFFGPP 273 >At1g70990.1 68414.m08190 proline-rich family protein Length = 176 Score = 27.5 bits (58), Expect = 6.2 Identities = 16/38 (42%), Positives = 19/38 (50%), Gaps = 4/38 (10%) Frame = +3 Query: 30 PNQNYERPPXPLNKPKTIYGPPKVYGPPKSY----GPP 131 P+Q PP P + PK Y PP PP +Y GPP Sbjct: 104 PSQACPPPPLPPSPPKKSYCPP----PPSTYIYMTGPP 137 >At1g70620.1 68414.m08138 cyclin-related contains weak similarity to Swiss-Prot:P35662 cylicin I (Multiple-band polypeptide I) [Bos taurus] Length = 897 Score = 27.5 bits (58), Expect = 6.2 Identities = 15/54 (27%), Positives = 26/54 (48%), Gaps = 1/54 (1%) Frame = +1 Query: 169 KRRMALPSPSRRTVHHLKYQNS*RNHS-HRNHTMDLLNQSTDLQSQLRQHTAHR 327 KR+ PSP + H+ ++ HS H+N ++S +S+ R + HR Sbjct: 840 KRKNRSPSPGKSRRRHVSSRSPHSKHSQHKNTLYSSHDKSRSKRSRSRSRSPHR 893 >At1g62440.1 68414.m07044 leucine-rich repeat family protein / extensin family protein similar to extensin-like protein [Lycopersicon esculentum] gi|5917664|gb|AAD55979; contains leucine-rich repeats, Pfam:PF00560; contains proline rich extensin domains, INTERPRO:IPR002965 Length = 826 Score = 27.5 bits (58), Expect = 6.2 Identities = 13/29 (44%), Positives = 15/29 (51%), Gaps = 2/29 (6%) Frame = +3 Query: 51 PPXPLNKPKTIYGPPKVYG--PPKSYGPP 131 PP PL+ P PP +Y PP S PP Sbjct: 529 PPPPLSPPPPSPPPPYIYSSPPPPSPSPP 557 >At1g61080.1 68414.m06877 proline-rich family protein Length = 907 Score = 27.5 bits (58), Expect = 6.2 Identities = 14/33 (42%), Positives = 16/33 (48%), Gaps = 1/33 (3%) Frame = +3 Query: 51 PPXPLNKPKTIYGPPKVYGPPK-SYGPPKLGPP 146 PP P P TI PP PP+ + PP PP Sbjct: 510 PPPPPPLPTTIAAPPPPPPPPRAAVAPPPPPPP 542 >At1g10390.1 68414.m01171 nucleoporin family protein contains Pfam profiles: PF04096 nucleoporin autopeptidase, PF03093 nucleoporin FG repeat family Length = 1041 Score = 27.5 bits (58), Expect = 6.2 Identities = 16/59 (27%), Positives = 26/59 (44%), Gaps = 1/59 (1%) Frame = +3 Query: 354 ELPPIQLPTVTTVETNIGTN-FGGDFGVNFADSHGVDFGGTFGSNFDSGANLPAPIYGT 527 + P I + T +N G++ FG N S FGS+ G P+P++G+ Sbjct: 450 QTPTIASSSFGTATSNFGSSPFGVTSSSNLFGSGSSTTTSVFGSSSAFGTTTPSPLFGS 508 >At5g42860.1 68418.m05224 expressed protein Length = 320 Score = 27.1 bits (57), Expect = 8.2 Identities = 14/34 (41%), Positives = 17/34 (50%) Frame = +3 Query: 51 PPXPLNKPKTIYGPPKVYGPPKSYGPPKLGPPKL 152 PP P+ KPK GP + PP PP P +L Sbjct: 241 PPAPIPKPKKKKGPIVIVEPP---APPAPVPMRL 271 >At5g15780.1 68418.m01845 pollen Ole e 1 allergen and extensin family protein contains Pfam profile PF01190: Pollen proteins Ole e I family Length = 401 Score = 27.1 bits (57), Expect = 8.2 Identities = 11/27 (40%), Positives = 14/27 (51%) Frame = +3 Query: 51 PPXPLNKPKTIYGPPKVYGPPKSYGPP 131 PP P+ P I PP + PP S+ P Sbjct: 334 PPLPVLPPVPIVNPPSLPPPPPSFPVP 360 >At3g51180.1 68416.m05603 zinc finger (CCCH-type) family protein contains Pfam domain, PF00642: Zinc finger C-x8-C-x5-C-x3-H type (and similar) Length = 521 Score = 27.1 bits (57), Expect = 8.2 Identities = 10/30 (33%), Positives = 16/30 (53%) Frame = +3 Query: 33 NQNYERPPXPLNKPKTIYGPPKVYGPPKSY 122 N N+ RPP ++PK I P + P ++ Sbjct: 357 NLNFHRPPNVFSEPKVIVNPQPQHQPYSAF 386 >At3g24550.1 68416.m03083 protein kinase family protein contains Pfam domain PF00069: Protein kinase domain Length = 652 Score = 27.1 bits (57), Expect = 8.2 Identities = 20/50 (40%), Positives = 22/50 (44%), Gaps = 4/50 (8%) Frame = -2 Query: 496 PESKFDPKVPPKSTPWLSAKFTPK----SPPKFVPMFVSTVVTVGSCIGG 359 P S P P +TP S TP SPP +ST V VG IGG Sbjct: 99 PRSPPSPNQGPPNTPSGSTPRTPSNTKPSPPSDSSDGLSTGVVVGIAIGG 148 >At2g36020.1 68415.m04423 abscisic acid-responsive HVA22 family protein weak similarity to SP|Q00765 Polyposis locus protein 1 (TB2 protein) {Homo sapiens}; contains Pfam profile PF03134: TB2/DP1, HVA22 family Length = 258 Score = 27.1 bits (57), Expect = 8.2 Identities = 14/27 (51%), Positives = 16/27 (59%) Frame = +3 Query: 453 GVDFGGTFGSNFDSGANLPAPIYGTPL 533 G D GTF N D G N+P I G+PL Sbjct: 216 GRDSAGTF--NGDDGVNIPDTIPGSPL 240 >At1g63830.2 68414.m07224 proline-rich family protein contains proline-rich extensin domains, INTERPRO:IPR002965; contains 1 predicted transmembrane domain Length = 232 Score = 27.1 bits (57), Expect = 8.2 Identities = 13/31 (41%), Positives = 19/31 (61%), Gaps = 1/31 (3%) Frame = +3 Query: 42 YERP-PXPLNKPKTIYGPPKVYGPPKSYGPP 131 +++P P P+ P++ Y PP PP SY PP Sbjct: 198 FDQPVPPPVGYPQS-YPPPAQGYPPASYPPP 227 >At1g63830.1 68414.m07223 proline-rich family protein contains proline-rich extensin domains, INTERPRO:IPR002965; contains 1 predicted transmembrane domain Length = 232 Score = 27.1 bits (57), Expect = 8.2 Identities = 13/31 (41%), Positives = 19/31 (61%), Gaps = 1/31 (3%) Frame = +3 Query: 42 YERP-PXPLNKPKTIYGPPKVYGPPKSYGPP 131 +++P P P+ P++ Y PP PP SY PP Sbjct: 198 FDQPVPPPVGYPQS-YPPPAQGYPPASYPPP 227 >At1g17060.1 68414.m02075 cytochrome P450, putative 41% identical to Cytochrome P450 [Catharanthus roseus] (gi|404690) Length = 476 Score = 27.1 bits (57), Expect = 8.2 Identities = 10/22 (45%), Positives = 14/22 (63%) Frame = -1 Query: 317 VCCLNWLWRSVDWFRRSIVWFR 252 + LNW+WR+V+W VW R Sbjct: 17 ILILNWVWRAVNW-----VWLR 33 >At1g04860.1 68414.m00482 ubiquitin-specific protease 2 (UBP2) identical to GI:11993463 Length = 961 Score = 27.1 bits (57), Expect = 8.2 Identities = 16/39 (41%), Positives = 18/39 (46%) Frame = -2 Query: 475 KVPPKSTPWLSAKFTPKSPPKFVPMFVSTVVTVGSCIGG 359 K PPK +S K PPK VP VS V V + G Sbjct: 389 KSPPKKPQPVSRAKKAKLPPKRVPKNVSKVSKVSKVLPG 427 Database: arabidopsis Posted date: Oct 4, 2007 10:56 AM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 12,116,741 Number of Sequences: 28952 Number of extensions: 279045 Number of successful extensions: 1488 Number of sequences better than 10.0: 54 Number of HSP's better than 10.0 without gapping: 951 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1372 length of database: 12,070,560 effective HSP length: 77 effective length of database: 9,841,256 effective search space used: 1023490624 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -