BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= S06A01NCLL0001_O16 (418 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value AF144379-1|AAD34586.1| 543|Apis mellifera glutamate transporter... 24 0.79 AB269871-1|BAF03050.1| 1923|Apis mellifera cell adhesion molecul... 22 3.2 AB257298-1|BAE93381.1| 1919|Apis mellifera Dscam family member A... 22 3.2 DQ342041-1|ABC69933.1| 828|Apis mellifera STIP protein. 21 7.4 DQ494417-1|ABF55368.1| 42|Apis mellifera telomerase reverse tr... 20 9.7 >AF144379-1|AAD34586.1| 543|Apis mellifera glutamate transporter Am-EAAT protein. Length = 543 Score = 23.8 bits (49), Expect = 0.79 Identities = 11/52 (21%), Positives = 25/52 (48%) Frame = -3 Query: 302 ACVYIITQEILIQPGAPAVLFIAKYFQTIHTVKVQRTS*LGLFISLVPQNFI 147 A + I ++I PG P + + ++ +T + L + ++VP+N + Sbjct: 149 AAIVGIVMVLIIHPGDPRIKSVVTAYKADYTKISTLDAILDIIRNMVPENLV 200 >AB269871-1|BAF03050.1| 1923|Apis mellifera cell adhesion molecule AbsCAM-Ig7B protein. Length = 1923 Score = 21.8 bits (44), Expect = 3.2 Identities = 9/34 (26%), Positives = 19/34 (55%) Frame = -3 Query: 233 KYFQTIHTVKVQRTS*LGLFISLVPQNFINLTKY 132 +Y+ TIH V +Q+ + G +P+ +++ Y Sbjct: 1664 RYYATIHKVALQQAANTGGGPDKIPETAEDISPY 1697 >AB257298-1|BAE93381.1| 1919|Apis mellifera Dscam family member AbsCAM-Ig7A protein. Length = 1919 Score = 21.8 bits (44), Expect = 3.2 Identities = 9/34 (26%), Positives = 19/34 (55%) Frame = -3 Query: 233 KYFQTIHTVKVQRTS*LGLFISLVPQNFINLTKY 132 +Y+ TIH V +Q+ + G +P+ +++ Y Sbjct: 1660 RYYATIHKVALQQAANTGGGPDKIPETAEDISPY 1693 >DQ342041-1|ABC69933.1| 828|Apis mellifera STIP protein. Length = 828 Score = 20.6 bits (41), Expect = 7.4 Identities = 8/24 (33%), Positives = 13/24 (54%) Frame = +3 Query: 315 NYSPGYPSLSDPVFIWKKFVISKI 386 N+SP Y +++ WK + KI Sbjct: 663 NHSPNYDQVTNWYMGWKGMLSEKI 686 >DQ494417-1|ABF55368.1| 42|Apis mellifera telomerase reverse transcriptase protein. Length = 42 Score = 20.2 bits (40), Expect = 9.7 Identities = 8/22 (36%), Positives = 13/22 (59%) Frame = +3 Query: 45 LHETFPPYFKYYWIFNLFMIKK 110 L + F YF+ Y + + +IKK Sbjct: 10 LKKDFGTYFQQYCLHHKILIKK 31 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 109,257 Number of Sequences: 438 Number of extensions: 2046 Number of successful extensions: 5 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 5 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 5 length of database: 146,343 effective HSP length: 52 effective length of database: 123,567 effective search space used: 10626762 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 40 (21.2 bits)
- SilkBase 1999-2023 -