BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= S06A01NCLL0001_O13 (417 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_31829| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 5e-04 SB_54230| Best HMM Match : EGF (HMM E-Value=0) 30 0.67 SB_59616| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 1.2 SB_16007| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 2.7 SB_13460| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 2.7 SB_28918| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 2.7 SB_37509| Best HMM Match : PAE (HMM E-Value=0) 27 4.7 SB_59641| Best HMM Match : PAE (HMM E-Value=0) 27 4.7 SB_56531| Best HMM Match : SLH (HMM E-Value=1.1) 27 4.7 SB_45684| Best HMM Match : T-box (HMM E-Value=1.5e-32) 27 4.7 SB_20601| Best HMM Match : F5_F8_type_C (HMM E-Value=9.5e-24) 27 4.7 SB_10202| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 6.2 SB_20131| Best HMM Match : RVT_1 (HMM E-Value=0.0049) 27 8.2 >SB_31829| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 72 Score = 40.7 bits (91), Expect = 5e-04 Identities = 22/71 (30%), Positives = 33/71 (46%) Frame = +2 Query: 146 TPFGQVKLNEIGGWLGRRSKTPSAVMGACSRAWWRWQHKYVQPKKVGMAPFFQLLVGSMT 325 T FG+ KL G ++ R + + G SR W ++ KYV K M PF+ + + Sbjct: 2 TSFGETKLKNAGDYVVRNASLENMWRGM-SRVWNSYRAKYVTCKNARMTPFWHAVFVAAA 60 Query: 326 FFYMINYGKMK 358 Y I Y +K Sbjct: 61 LNYAIEYNHLK 71 >SB_54230| Best HMM Match : EGF (HMM E-Value=0) Length = 1359 Score = 30.3 bits (65), Expect = 0.67 Identities = 15/31 (48%), Positives = 21/31 (67%) Frame = +3 Query: 51 CEKKWLSVITRKNTTLLSTGRMIQPVIMASL 143 CEK W SVI+R+ TTL+ R + V +A+L Sbjct: 1093 CEKAWTSVISRQ-TTLVRMERPVSTVTVATL 1122 >SB_59616| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 2735 Score = 29.5 bits (63), Expect = 1.2 Identities = 11/26 (42%), Positives = 17/26 (65%) Frame = -3 Query: 322 HAANKQLEEWSHAYFFRLNIFVLPPP 245 H+A K LE W+ + RL+++ PPP Sbjct: 2285 HSAMKMLELWTQTFLGRLDMYQGPPP 2310 >SB_16007| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 326 Score = 28.3 bits (60), Expect = 2.7 Identities = 10/19 (52%), Positives = 13/19 (68%) Frame = +2 Query: 131 YGKPDTPFGQVKLNEIGGW 187 YG+ PFG+ KL +IG W Sbjct: 164 YGEQKIPFGEQKLEQIGPW 182 >SB_13460| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 85 Score = 28.3 bits (60), Expect = 2.7 Identities = 11/49 (22%), Positives = 26/49 (53%) Frame = +2 Query: 236 RAWWRWQHKYVQPKKVGMAPFFQLLVGSMTFFYMINYGKMKHHRNYKYH 382 R + ++H + V + F +L V + ++ + Y +H+R+Y+Y+ Sbjct: 21 RNYRHYRHTVITVSTVNLLAFVKLSVYVTSPYFPVVYRSNRHYRHYRYY 69 >SB_28918| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 319 Score = 28.3 bits (60), Expect = 2.7 Identities = 12/29 (41%), Positives = 16/29 (55%) Frame = +2 Query: 296 FFQLLVGSMTFFYMINYGKMKHHRNYKYH 382 FF L M FFY+ Y K++HH+ H Sbjct: 184 FFVLPFALMCFFYLKIYLKIRHHKKQTAH 212 >SB_37509| Best HMM Match : PAE (HMM E-Value=0) Length = 483 Score = 27.5 bits (58), Expect = 4.7 Identities = 10/24 (41%), Positives = 14/24 (58%) Frame = +1 Query: 277 KSRHGSILPTACWQHDFLLYDQLW 348 +SR +L T+C +H LYD W Sbjct: 418 RSRTSGLLLTSCMEHSQSLYDDTW 441 >SB_59641| Best HMM Match : PAE (HMM E-Value=0) Length = 1252 Score = 27.5 bits (58), Expect = 4.7 Identities = 10/24 (41%), Positives = 14/24 (58%) Frame = +1 Query: 277 KSRHGSILPTACWQHDFLLYDQLW 348 +SR +L T+C +H LYD W Sbjct: 1187 RSRTSGLLLTSCMEHSQSLYDDTW 1210 >SB_56531| Best HMM Match : SLH (HMM E-Value=1.1) Length = 151 Score = 27.5 bits (58), Expect = 4.7 Identities = 16/52 (30%), Positives = 21/52 (40%) Frame = -2 Query: 179 RFHSVLPVQRVYQACHNNGLDHTARGQQGCILSGNHRKPFFLTNLSNTIENR 24 RF S L Q + ++ T Q +GNH KPF N + NR Sbjct: 93 RFISCLTPQNPVYRLVQDRIEATTHSYQLRTRTGNHIKPFATNRFGNFVTNR 144 >SB_45684| Best HMM Match : T-box (HMM E-Value=1.5e-32) Length = 337 Score = 27.5 bits (58), Expect = 4.7 Identities = 15/47 (31%), Positives = 22/47 (46%), Gaps = 1/47 (2%) Frame = +2 Query: 110 PYDPARYYGKPDTPF-GQVKLNEIGGWLGRRSKTPSAVMGACSRAWW 247 P P R Y PD+PF G+ LN R+S +P+ + +W Sbjct: 259 PPAPVRLYMHPDSPFTGEQLLNRSS--RSRKSSSPTTTQTTMATIYW 303 >SB_20601| Best HMM Match : F5_F8_type_C (HMM E-Value=9.5e-24) Length = 405 Score = 27.5 bits (58), Expect = 4.7 Identities = 20/68 (29%), Positives = 31/68 (45%), Gaps = 2/68 (2%) Frame = +2 Query: 185 WLGRRSKTPSAVMGACSRAWWRWQHKYVQPKKVGMAPFFQLLVGSMTFFYMINYGKMK-- 358 + G TP VM + ++ W R++ QP VG F+ + S + N G +K Sbjct: 318 YCGEFEVTPRPVMSSSNKLWIRFRSNSSQP-SVG---FYAVYFPSCNAYLTNNSGVIKSP 373 Query: 359 HHRNYKYH 382 +H N YH Sbjct: 374 NHPNEYYH 381 >SB_10202| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1165 Score = 27.1 bits (57), Expect = 6.2 Identities = 11/19 (57%), Positives = 13/19 (68%) Frame = -1 Query: 234 LQAPITAEGVLLLRPNHPP 178 L PI GV +LRP+HPP Sbjct: 51 LDEPIPEIGVPILRPSHPP 69 >SB_20131| Best HMM Match : RVT_1 (HMM E-Value=0.0049) Length = 186 Score = 26.6 bits (56), Expect = 8.2 Identities = 12/23 (52%), Positives = 14/23 (60%) Frame = +1 Query: 322 DFLLYDQLWQDEAPQELQVPLNE 390 D LY L DE+P LQ PLN+ Sbjct: 120 DCALYLHLTSDESPSHLQQPLNK 142 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 13,900,634 Number of Sequences: 59808 Number of extensions: 306629 Number of successful extensions: 831 Number of sequences better than 10.0: 13 Number of HSP's better than 10.0 without gapping: 770 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 831 length of database: 16,821,457 effective HSP length: 75 effective length of database: 12,335,857 effective search space used: 777158991 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -