BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= S06A01NCLL0001_O13 (417 letters) Database: human 237,096 sequences; 76,859,062 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value CR542155-1|CAG46952.1| 94|Homo sapiens ATP5J2 protein. 59 5e-09 CR456891-1|CAG33172.1| 94|Homo sapiens ATP5J2 protein. 59 5e-09 AY046911-1|AAL06647.1| 88|Homo sapiens F1Fo-ATP synthase compl... 59 5e-09 AF088918-1|AAC34895.1| 94|Homo sapiens F1F0-type ATPase subuni... 59 5e-09 AK223348-1|BAD97068.1| 94|Homo sapiens ATP synthase, H+ transp... 59 7e-09 BC003678-1|AAH03678.1| 94|Homo sapiens ATP synthase, H+ transp... 58 1e-08 AL834261-1|CAD38936.1| 377|Homo sapiens hypothetical protein pr... 30 3.6 BC142702-1|AAI42703.1| 355|Homo sapiens vacuolar protein sortin... 29 6.2 BC141827-1|AAI41828.1| 355|Homo sapiens vacuolar protein sortin... 29 6.2 BC089447-1|AAH89447.1| 981|Homo sapiens proline-rich transmembr... 29 8.2 AK090993-1|BAC03564.1| 667|Homo sapiens protein ( Homo sapiens ... 29 8.2 >CR542155-1|CAG46952.1| 94|Homo sapiens ATP5J2 protein. Length = 94 Score = 59.3 bits (137), Expect = 5e-09 Identities = 26/75 (34%), Positives = 42/75 (56%) Frame = +2 Query: 158 QVKLNEIGGWLGRRSKTPSAVMGACSRAWWRWQHKYVQPKKVGMAPFFQLLVGSMTFFYM 337 +VKL E+ W+ R +PS + GA R ++R+ +KY+ KK ++ +L + F Y Sbjct: 20 EVKLGELPSWILMRDFSPSGIFGAFQRGYYRYYNKYINVKKGSISGITMVLACYVLFSYS 79 Query: 338 INYGKMKHHRNYKYH 382 +Y +KH R KYH Sbjct: 80 FSYKHLKHERLRKYH 94 >CR456891-1|CAG33172.1| 94|Homo sapiens ATP5J2 protein. Length = 94 Score = 59.3 bits (137), Expect = 5e-09 Identities = 26/75 (34%), Positives = 42/75 (56%) Frame = +2 Query: 158 QVKLNEIGGWLGRRSKTPSAVMGACSRAWWRWQHKYVQPKKVGMAPFFQLLVGSMTFFYM 337 +VKL E+ W+ R +PS + GA R ++R+ +KY+ KK ++ +L + F Y Sbjct: 20 EVKLGELPSWILMRDFSPSGIFGAFQRGYYRYYNKYINVKKGSISGITMVLACYVLFSYS 79 Query: 338 INYGKMKHHRNYKYH 382 +Y +KH R KYH Sbjct: 80 FSYKHLKHERLRKYH 94 >AY046911-1|AAL06647.1| 88|Homo sapiens F1Fo-ATP synthase complex Fo membrane domain f subunit protein. Length = 88 Score = 59.3 bits (137), Expect = 5e-09 Identities = 26/75 (34%), Positives = 42/75 (56%) Frame = +2 Query: 158 QVKLNEIGGWLGRRSKTPSAVMGACSRAWWRWQHKYVQPKKVGMAPFFQLLVGSMTFFYM 337 +VKL E+ W+ R +PS + GA R ++R+ +KY+ KK ++ +L + F Y Sbjct: 14 EVKLGELPSWILMRDFSPSGIFGAFQRGYYRYYNKYINVKKGSISGITMVLACYVLFSYS 73 Query: 338 INYGKMKHHRNYKYH 382 +Y +KH R KYH Sbjct: 74 FSYKHLKHERLRKYH 88 >AF088918-1|AAC34895.1| 94|Homo sapiens F1F0-type ATPase subunit f protein. Length = 94 Score = 59.3 bits (137), Expect = 5e-09 Identities = 26/75 (34%), Positives = 42/75 (56%) Frame = +2 Query: 158 QVKLNEIGGWLGRRSKTPSAVMGACSRAWWRWQHKYVQPKKVGMAPFFQLLVGSMTFFYM 337 +VKL E+ W+ R +PS + GA R ++R+ +KY+ KK ++ +L + F Y Sbjct: 20 EVKLGELPSWILMRDFSPSGIFGAFQRGYYRYYNKYINVKKGSISGITMVLACYVLFSYS 79 Query: 338 INYGKMKHHRNYKYH 382 +Y +KH R KYH Sbjct: 80 FSYKHLKHERLRKYH 94 >AK223348-1|BAD97068.1| 94|Homo sapiens ATP synthase, H+ transporting, mitochondrial F0 complex, subunit f isoform 2a v protein. Length = 94 Score = 58.8 bits (136), Expect = 7e-09 Identities = 26/75 (34%), Positives = 42/75 (56%) Frame = +2 Query: 158 QVKLNEIGGWLGRRSKTPSAVMGACSRAWWRWQHKYVQPKKVGMAPFFQLLVGSMTFFYM 337 +VKL E+ W+ R +PS + GA R ++R+ +KY+ KK ++ +L + F Y Sbjct: 20 EVKLGELPSWVLMRDFSPSGIFGAFQRGYYRYYNKYINVKKGSISGITMVLACYVLFSYS 79 Query: 338 INYGKMKHHRNYKYH 382 +Y +KH R KYH Sbjct: 80 FSYKHLKHERLRKYH 94 >BC003678-1|AAH03678.1| 94|Homo sapiens ATP synthase, H+ transporting, mitochondrial F0 complex, subunit F2 protein. Length = 94 Score = 58.0 bits (134), Expect = 1e-08 Identities = 26/75 (34%), Positives = 42/75 (56%) Frame = +2 Query: 158 QVKLNEIGGWLGRRSKTPSAVMGACSRAWWRWQHKYVQPKKVGMAPFFQLLVGSMTFFYM 337 +VKL E+ W+ R +PS + GA R ++R+ +KY+ KK ++ +L + F Y Sbjct: 20 EVKLLELPSWILMRDFSPSGIFGAFQRGYYRYYNKYINVKKGSISGITMVLACYVLFSYS 79 Query: 338 INYGKMKHHRNYKYH 382 +Y +KH R KYH Sbjct: 80 FSYKHLKHERLRKYH 94 >AL834261-1|CAD38936.1| 377|Homo sapiens hypothetical protein protein. Length = 377 Score = 29.9 bits (64), Expect = 3.6 Identities = 21/76 (27%), Positives = 30/76 (39%), Gaps = 1/76 (1%) Frame = +2 Query: 62 MAFGDYPKEYNPAVHGPYDPARYYGKPDTPFGQVKLNEI-GGWLGRRSKTPSAVMGACSR 238 +A YP Y+P+ P P + P PF V G LG P+A +G Sbjct: 220 LAMPPYPLPYSPSPSLPVGPTAHGALPPAPFPVVSQPSFYSGPLG--PTYPAAQLGPRGA 277 Query: 239 AWWRWQHKYVQPKKVG 286 A + W + P + G Sbjct: 278 AGYSWSPQRSMPPRPG 293 >BC142702-1|AAI42703.1| 355|Homo sapiens vacuolar protein sorting 37 homolog C (S. cerevisiae) protein. Length = 355 Score = 29.1 bits (62), Expect = 6.2 Identities = 21/75 (28%), Positives = 29/75 (38%), Gaps = 1/75 (1%) Frame = +2 Query: 65 AFGDYPKEYNPAVHGPYDPARYYGKPDTPFGQVKLNEI-GGWLGRRSKTPSAVMGACSRA 241 A YP Y+P+ P P + P PF V G LG P+A +G A Sbjct: 199 AMPPYPLPYSPSPSLPVGPTAHGALPPAPFPVVSQPSFYSGPLG--PTYPAAQLGPRGAA 256 Query: 242 WWRWQHKYVQPKKVG 286 + W + P + G Sbjct: 257 GYSWSPQRSMPPRPG 271 >BC141827-1|AAI41828.1| 355|Homo sapiens vacuolar protein sorting 37 homolog C (S. cerevisiae) protein. Length = 355 Score = 29.1 bits (62), Expect = 6.2 Identities = 21/75 (28%), Positives = 29/75 (38%), Gaps = 1/75 (1%) Frame = +2 Query: 65 AFGDYPKEYNPAVHGPYDPARYYGKPDTPFGQVKLNEI-GGWLGRRSKTPSAVMGACSRA 241 A YP Y+P+ P P + P PF V G LG P+A +G A Sbjct: 199 AMPPYPLPYSPSPSLPVGPTAHGALPPAPFPVVSQPSFYSGPLG--PTYPAAQLGPRGAA 256 Query: 242 WWRWQHKYVQPKKVG 286 + W + P + G Sbjct: 257 GYSWSPQRSMPPRPG 271 >BC089447-1|AAH89447.1| 981|Homo sapiens proline-rich transmembrane protein 3 protein. Length = 981 Score = 28.7 bits (61), Expect = 8.2 Identities = 12/39 (30%), Positives = 19/39 (48%) Frame = +2 Query: 101 VHGPYDPARYYGKPDTPFGQVKLNEIGGWLGRRSKTPSA 217 + GP DP + ++P G ++ +E W GR P A Sbjct: 368 IPGPSDPGPAVNRTESPMGALQPDEAEEWPGRPQSHPPA 406 >AK090993-1|BAC03564.1| 667|Homo sapiens protein ( Homo sapiens cDNA FLJ33674 fis, clone BRAWH2002047. ). Length = 667 Score = 28.7 bits (61), Expect = 8.2 Identities = 12/39 (30%), Positives = 19/39 (48%) Frame = +2 Query: 101 VHGPYDPARYYGKPDTPFGQVKLNEIGGWLGRRSKTPSA 217 + GP DP + ++P G ++ +E W GR P A Sbjct: 368 IPGPSDPGPAVNRTESPMGALQPDEAEEWPGRPQSHPPA 406 Database: human Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 76,859,062 Number of sequences in database: 237,096 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 68,309,671 Number of Sequences: 237096 Number of extensions: 1650678 Number of successful extensions: 4013 Number of sequences better than 10.0: 11 Number of HSP's better than 10.0 without gapping: 3829 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 4013 length of database: 76,859,062 effective HSP length: 83 effective length of database: 57,180,094 effective search space used: 3144905170 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -