BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= S06A01NCLL0001_O13 (417 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At5g33406.1 68418.m03990 hAT dimerisation domain-containing prot... 29 1.7 At2g25180.1 68415.m03011 two-component responsive regulator fami... 28 2.9 At3g53330.1 68416.m05884 plastocyanin-like domain-containing pro... 27 3.8 At1g52030.2 68414.m05870 myrosinase-binding protein, putative (F... 27 3.8 At1g52030.1 68414.m05869 myrosinase-binding protein, putative (F... 27 3.8 At4g19760.1 68417.m02900 glycosyl hydrolase family 18 protein si... 27 5.1 At2g43970.2 68415.m05468 La domain-containing protein contains P... 27 5.1 At2g43970.1 68415.m05467 La domain-containing protein contains P... 27 5.1 At2g02835.1 68415.m00229 hypothetical protein 27 5.1 At5g45900.1 68418.m05645 autophagy 7 (APG7) nearly identical to ... 27 6.7 At5g39400.1 68418.m04773 pollen specific phosphatase, putative /... 27 6.7 At1g55380.1 68414.m06334 DC1 domain-containing protein contains ... 27 6.7 At5g07330.1 68418.m00837 expressed protein 26 8.9 At5g01900.1 68418.m00109 WRKY family transcription factor contai... 26 8.9 At1g55430.1 68414.m06340 DC1 domain-containing protein contains ... 26 8.9 >At5g33406.1 68418.m03990 hAT dimerisation domain-containing protein low similarity to transposase [Fusarium oxysporum f. sp. lycopersici] GI:3126916; contains Pfam profile PF05699: hAT family dimerisation domain Length = 485 Score = 28.7 bits (61), Expect = 1.7 Identities = 17/49 (34%), Positives = 26/49 (53%), Gaps = 4/49 (8%) Frame = +2 Query: 59 KMAFGDYPKEYNPAVHGPYDPARYYGKPDTPFGQ---VKLNEI-GGWLG 193 KMAF + ++ +H P A YY P+ +GQ + E+ GG+LG Sbjct: 123 KMAFEIIDRRWDIQLHRPLHAAGYYLNPEFHYGQPDDIGYEEVLGGFLG 171 >At2g25180.1 68415.m03011 two-component responsive regulator family protein / response regulator family protein contains Pfam profile: PF00072 response regulator receiver domain Length = 596 Score = 27.9 bits (59), Expect = 2.9 Identities = 15/53 (28%), Positives = 27/53 (50%) Frame = -3 Query: 322 HAANKQLEEWSHAYFFRLNIFVLPPPPGSAASAHNS*RSLTPATQPSADFIQF 164 H NK+LE WS+A ++ PPPP +++ N ++P D +++ Sbjct: 426 HQINKRLEHWSNA----VSSSTHPPPPAHNSNSINHQFDVSPLPHSRPDPLEW 474 >At3g53330.1 68416.m05884 plastocyanin-like domain-containing protein similar to mavicyanin SP:P80728 from [Cucurbita pepo] Length = 310 Score = 27.5 bits (58), Expect = 3.8 Identities = 10/30 (33%), Positives = 15/30 (50%) Frame = -3 Query: 253 PPPPGSAASAHNS*RSLTPATQPSADFIQF 164 PPPP + H R +TP+ P + + F Sbjct: 155 PPPPPPPSKTHEPSRRITPSPPPPSKILPF 184 >At1g52030.2 68414.m05870 myrosinase-binding protein, putative (F-ATMBP) identical to SP|Q9SAV1 Myrosinase binding protein-like f-AtMBP [Arabidopsis thaliana]; similar to myrosinase binding protein GI:1711295 from [Brassica napus]; contains Pfam PF01419: Jacalin-like lectin domain; identical to cDNA myrosinase-binding protein-like protein (MBP1.2) GI:6760446 Length = 642 Score = 27.5 bits (58), Expect = 3.8 Identities = 12/21 (57%), Positives = 12/21 (57%) Frame = +2 Query: 74 DYPKEYNPAVHGPYDPARYYG 136 DYP EY AV G YD YG Sbjct: 67 DYPNEYITAVGGSYDTVFGYG 87 >At1g52030.1 68414.m05869 myrosinase-binding protein, putative (F-ATMBP) identical to SP|Q9SAV1 Myrosinase binding protein-like f-AtMBP [Arabidopsis thaliana]; similar to myrosinase binding protein GI:1711295 from [Brassica napus]; contains Pfam PF01419: Jacalin-like lectin domain; identical to cDNA myrosinase-binding protein-like protein (MBP1.2) GI:6760446 Length = 642 Score = 27.5 bits (58), Expect = 3.8 Identities = 12/21 (57%), Positives = 12/21 (57%) Frame = +2 Query: 74 DYPKEYNPAVHGPYDPARYYG 136 DYP EY AV G YD YG Sbjct: 67 DYPNEYITAVGGSYDTVFGYG 87 >At4g19760.1 68417.m02900 glycosyl hydrolase family 18 protein similar to chitinase, class V GI:505267 from [Nicotiana tabacum] Length = 365 Score = 27.1 bits (57), Expect = 5.1 Identities = 21/64 (32%), Positives = 29/64 (45%), Gaps = 3/64 (4%) Frame = +2 Query: 62 MAFGDYPKEYNPAVHGPYDPARYYGKPDTPFGQVKLNEIGGWLGRRSKTP-SAVMG--AC 232 MA+ Y ++P V GP PA + P P G+ + + WL P AV+G C Sbjct: 202 MAYDFYGPGWSP-VTGP--PAALFHDPSNPAGRSGNSGLRKWLDEAKLPPKKAVLGFPYC 258 Query: 233 SRAW 244 AW Sbjct: 259 GWAW 262 >At2g43970.2 68415.m05468 La domain-containing protein contains Pfam profile PF05383: La domain Length = 529 Score = 27.1 bits (57), Expect = 5.1 Identities = 17/66 (25%), Positives = 28/66 (42%) Frame = -3 Query: 220 NS*RSLTPATQPSADFIQFYLSKGCIRLAIITGWIIRPVDSRVVFFRVITESHFFSQIYQ 41 N+ L Q SA K R++ IT I + SR++ + E H + + + Sbjct: 244 NNNSQLAAVLQNSAKLFVSEDGKKVRRISPITESAIEELQSRIIVAENLPEDHCYQNLMK 303 Query: 40 ILSKIG 23 I S +G Sbjct: 304 IFSTVG 309 >At2g43970.1 68415.m05467 La domain-containing protein contains Pfam profile PF05383: La domain Length = 545 Score = 27.1 bits (57), Expect = 5.1 Identities = 17/66 (25%), Positives = 28/66 (42%) Frame = -3 Query: 220 NS*RSLTPATQPSADFIQFYLSKGCIRLAIITGWIIRPVDSRVVFFRVITESHFFSQIYQ 41 N+ L Q SA K R++ IT I + SR++ + E H + + + Sbjct: 244 NNNSQLAAVLQNSAKLFVSEDGKKVRRISPITESAIEELQSRIIVAENLPEDHCYQNLMK 303 Query: 40 ILSKIG 23 I S +G Sbjct: 304 IFSTVG 309 >At2g02835.1 68415.m00229 hypothetical protein Length = 198 Score = 27.1 bits (57), Expect = 5.1 Identities = 10/25 (40%), Positives = 14/25 (56%) Frame = +2 Query: 80 PKEYNPAVHGPYDPARYYGKPDTPF 154 P+EY ++ PY P PD+PF Sbjct: 121 PEEYEDSLISPYIPEAVLRSPDSPF 145 >At5g45900.1 68418.m05645 autophagy 7 (APG7) nearly identical to autophagy 7 [Arabidopsis thaliana] GI:19912147; contains Pfam profile PF00899: ThiF family Length = 697 Score = 26.6 bits (56), Expect = 6.7 Identities = 10/20 (50%), Positives = 13/20 (65%) Frame = -3 Query: 304 LEEWSHAYFFRLNIFVLPPP 245 L++WS Y+F FVL PP Sbjct: 145 LKKWSFRYWFAFPAFVLDPP 164 >At5g39400.1 68418.m04773 pollen specific phosphatase, putative / phosphatase and tensin, putative (PTEN1) identical to phosphatase and tensin homolog [Arabidopsis thaliana] GI:21535746 Length = 412 Score = 26.6 bits (56), Expect = 6.7 Identities = 12/32 (37%), Positives = 17/32 (53%), Gaps = 1/32 (3%) Frame = +2 Query: 62 MAFGDYPKEYNPAVHGPYDPARYYGKPDT-PF 154 M D+ K YN + YDP +YG+ + PF Sbjct: 87 MRHPDHYKVYNLCIEESYDPDNFYGRVERFPF 118 >At1g55380.1 68414.m06334 DC1 domain-containing protein contains Pfam profile PF03107: DC1 domain Length = 661 Score = 26.6 bits (56), Expect = 6.7 Identities = 8/13 (61%), Positives = 11/13 (84%) Frame = -1 Query: 195 RPNHPPISFSFTC 157 RP+HPP+S F+C Sbjct: 31 RPSHPPLSICFSC 43 >At5g07330.1 68418.m00837 expressed protein Length = 165 Score = 26.2 bits (55), Expect = 8.9 Identities = 13/39 (33%), Positives = 20/39 (51%) Frame = -3 Query: 238 SAASAHNS*RSLTPATQPSADFIQFYLSKGCIRLAIITG 122 +AA+ + R+ T A DF Y+S G I L++ G Sbjct: 33 TAATEYGGQRTATTAAATKGDFTPVYVSIGLISLSVTFG 71 >At5g01900.1 68418.m00109 WRKY family transcription factor contains Pfam profile: PF03106 WRKY DNA binding domain Length = 263 Score = 26.2 bits (55), Expect = 8.9 Identities = 16/36 (44%), Positives = 18/36 (50%), Gaps = 6/36 (16%) Frame = -1 Query: 255 CHLHQARLQAPITA------EGVLLLRPNHPPISFS 166 C LHQA PI EG ++R HP ISFS Sbjct: 169 CQLHQAYATFPIDTSDFEEHEGSHMIRFGHPNISFS 204 >At1g55430.1 68414.m06340 DC1 domain-containing protein contains Pfam profile PF03107: DC1 domain Length = 657 Score = 26.2 bits (55), Expect = 8.9 Identities = 8/13 (61%), Positives = 10/13 (76%) Frame = -1 Query: 195 RPNHPPISFSFTC 157 +P HPP+S FTC Sbjct: 37 QPTHPPLSICFTC 49 Database: arabidopsis Posted date: Oct 4, 2007 10:56 AM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 9,793,034 Number of Sequences: 28952 Number of extensions: 215516 Number of successful extensions: 639 Number of sequences better than 10.0: 15 Number of HSP's better than 10.0 without gapping: 624 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 639 length of database: 12,070,560 effective HSP length: 74 effective length of database: 9,928,112 effective search space used: 635399168 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -