BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= S06A01NCLL0001_O12 (472 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AF487533-1|AAL93294.1| 531|Anopheles gambiae cytochrome P450 CY... 26 0.76 AJ441131-1|CAD29630.1| 567|Anopheles gambiae putative chitin bi... 24 2.3 AJ439060-17|CAD27768.1| 568|Anopheles gambiae putative chitin b... 24 2.3 Z69976-1|CAA93816.1| 204|Anopheles gambiae ribosomal protein RL... 23 4.1 CR954256-7|CAJ14148.1| 1087|Anopheles gambiae predicted protein ... 23 5.4 AY745218-1|AAU93485.1| 159|Anopheles gambiae cytochrome P450 pr... 23 7.1 AJ439353-10|CAD27932.1| 3325|Anopheles gambiae F25C8.3 protein p... 22 9.4 AB090813-2|BAC57902.1| 1099|Anopheles gambiae reverse transcript... 22 9.4 >AF487533-1|AAL93294.1| 531|Anopheles gambiae cytochrome P450 CYP9K1 protein. Length = 531 Score = 25.8 bits (54), Expect = 0.76 Identities = 11/23 (47%), Positives = 15/23 (65%) Frame = -2 Query: 171 AREAVRHFGPAPGAPRSHTKPYV 103 A E +R + PAP R+ TKPY+ Sbjct: 387 ANETLRKWTPAPFLDRTCTKPYM 409 >AJ441131-1|CAD29630.1| 567|Anopheles gambiae putative chitin binding protein protein. Length = 567 Score = 24.2 bits (50), Expect = 2.3 Identities = 15/45 (33%), Positives = 19/45 (42%) Frame = +1 Query: 277 SFLSNV*CGYCHFRNGVKPHIIGDCANDYSDQTLACRLLHVACQT 411 +F S V Y F G + H G Y D+ L C + HV T Sbjct: 368 NFTSKVDLPYTTFNCGEQKHFPGL----YGDEDLGCMVFHVCALT 408 >AJ439060-17|CAD27768.1| 568|Anopheles gambiae putative chitin binding protein protein. Length = 568 Score = 24.2 bits (50), Expect = 2.3 Identities = 15/45 (33%), Positives = 19/45 (42%) Frame = +1 Query: 277 SFLSNV*CGYCHFRNGVKPHIIGDCANDYSDQTLACRLLHVACQT 411 +F S V Y F G + H G Y D+ L C + HV T Sbjct: 376 NFTSKVDLPYTTFNCGEQKHFPGL----YGDEDLGCMVFHVCALT 416 >Z69976-1|CAA93816.1| 204|Anopheles gambiae ribosomal protein RL10 protein. Length = 204 Score = 23.4 bits (48), Expect = 4.1 Identities = 15/46 (32%), Positives = 21/46 (45%), Gaps = 4/46 (8%) Frame = -2 Query: 231 QLALRAPTGRKTVLVQGRRNAREAVRHFGPAPGAPRSH----TKPY 106 +L +A TG ++ R R+ H G G P+SH KPY Sbjct: 50 RLGYKAKTGFSIFRIRVRCGGRKRPVHKGCTYGKPKSHGVNQLKPY 95 >CR954256-7|CAJ14148.1| 1087|Anopheles gambiae predicted protein protein. Length = 1087 Score = 23.0 bits (47), Expect = 5.4 Identities = 8/18 (44%), Positives = 12/18 (66%) Frame = +1 Query: 406 QTGQRTRRSVDTAHKQSP 459 +T R S+DT+HK +P Sbjct: 44 ETAHRMAESMDTSHKPNP 61 >AY745218-1|AAU93485.1| 159|Anopheles gambiae cytochrome P450 protein. Length = 159 Score = 22.6 bits (46), Expect = 7.1 Identities = 11/27 (40%), Positives = 14/27 (51%) Frame = +1 Query: 385 RLLHVACQTGQRTRRSVDTAHKQSP*D 465 RLL +A G+RT VD + P D Sbjct: 64 RLLPIAAVVGRRTTAEVDLGQYRLPAD 90 >AJ439353-10|CAD27932.1| 3325|Anopheles gambiae F25C8.3 protein protein. Length = 3325 Score = 22.2 bits (45), Expect = 9.4 Identities = 8/17 (47%), Positives = 12/17 (70%) Frame = +3 Query: 174 YGDPEPVLSYVQWAHGG 224 Y D +++YV+ AHGG Sbjct: 823 YCDVRQLITYVKGAHGG 839 >AB090813-2|BAC57902.1| 1099|Anopheles gambiae reverse transcriptase protein. Length = 1099 Score = 22.2 bits (45), Expect = 9.4 Identities = 8/20 (40%), Positives = 13/20 (65%) Frame = -1 Query: 310 DSSRTTRY*ESSCPHLGCWR 251 D+SR TR+ P++G W+ Sbjct: 886 DTSRHTRWAHRVLPNIGSWQ 905 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 526,254 Number of Sequences: 2352 Number of extensions: 11095 Number of successful extensions: 30 Number of sequences better than 10.0: 8 Number of HSP's better than 10.0 without gapping: 30 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 30 length of database: 563,979 effective HSP length: 59 effective length of database: 425,211 effective search space used: 41245467 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -