BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= S06A01NCLL0001_O09 (458 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_17567| Best HMM Match : DnaJ (HMM E-Value=0.0007) 27 7.5 SB_18885| Best HMM Match : NAD_synthase (HMM E-Value=1.9e-07) 27 9.9 >SB_17567| Best HMM Match : DnaJ (HMM E-Value=0.0007) Length = 831 Score = 27.1 bits (57), Expect = 7.5 Identities = 13/48 (27%), Positives = 27/48 (56%) Frame = -2 Query: 184 KSKGPLVTRSNFSYLPKNSRQHRCSCSGDYLRYK*KSKANSQNFNHSL 41 KSKG +++ F+Y+PK ++ + S D + + +SK + ++ L Sbjct: 236 KSKGMPQSQTGFTYVPKKAQDYYGLDSFDVINHSTQSKTPLSSMDYGL 283 >SB_18885| Best HMM Match : NAD_synthase (HMM E-Value=1.9e-07) Length = 145 Score = 26.6 bits (56), Expect = 9.9 Identities = 9/20 (45%), Positives = 15/20 (75%) Frame = -1 Query: 386 RSFILHCVLNFSYGTLIIVL 327 R+FI HCV +++ +LI +L Sbjct: 105 RAFIFHCVEKYNFSSLITIL 124 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 13,025,357 Number of Sequences: 59808 Number of extensions: 232223 Number of successful extensions: 405 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 376 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 405 length of database: 16,821,457 effective HSP length: 76 effective length of database: 12,276,049 effective search space used: 932979724 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -