BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= S06A01NCLL0001_O08 (405 letters) Database: spombe 5004 sequences; 2,362,478 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SPBC13E7.11 ||SPBC30D10.19c|mitochondrial rhomboid protease|Schi... 24 7.8 SPBC11C11.04c |alp1||tubulin specific chaperone cofactor D |Schi... 24 7.8 >SPBC13E7.11 ||SPBC30D10.19c|mitochondrial rhomboid protease|Schizosaccharomyces pombe|chr 2|||Manual Length = 298 Score = 24.2 bits (50), Expect = 7.8 Identities = 11/43 (25%), Positives = 23/43 (53%) Frame = -1 Query: 135 MVFLFNHFCY*IICFKLIHFYSFIKCLILIYISNQSCNYSIKA 7 +V F+H + F ++ FYSF ++ ++ +NQ + I + Sbjct: 123 IVSAFSHQSGWHLLFNMVAFYSFAPAIVDVFGNNQFVAFYISS 165 >SPBC11C11.04c |alp1||tubulin specific chaperone cofactor D |Schizosaccharomyces pombe|chr 2|||Manual Length = 1107 Score = 24.2 bits (50), Expect = 7.8 Identities = 9/26 (34%), Positives = 13/26 (50%) Frame = -1 Query: 111 CY*IICFKLIHFYSFIKCLILIYISN 34 CY +C K+ HF F C+ +N Sbjct: 511 CYGDLCMKVAHFPQFRSCVFQRLFTN 536 Database: spombe Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 2,362,478 Number of sequences in database: 5004 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 1,234,179 Number of Sequences: 5004 Number of extensions: 18854 Number of successful extensions: 40 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 40 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 40 length of database: 2,362,478 effective HSP length: 66 effective length of database: 2,032,214 effective search space used: 138190552 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -