BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= S06A01NCLL0001_O08 (405 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 07_03_0342 + 16963528-16963598,16963668-16964235,16964350-169647... 28 2.4 05_01_0260 - 1993075-1994312,1996249-1997191 28 2.4 08_02_1372 + 26500093-26500154,26500733-26500933,26501858-265019... 27 5.6 >07_03_0342 + 16963528-16963598,16963668-16964235,16964350-16964760, 16964848-16965051,16968663-16969032,16972466-16972601, 16972680-16972779,16972933-16973190,16973276-16973314, 16973420-16973458 Length = 731 Score = 28.3 bits (60), Expect = 2.4 Identities = 12/39 (30%), Positives = 20/39 (51%) Frame = +1 Query: 49 QDQAFYKTVEMYQFEANDLITKMIEEKNHAGGQNVYGAN 165 +DQ Y+ + Q +DL+TK + K H G G++ Sbjct: 205 EDQRVYEAIAYSQRREDDLLTKALGNKEHRGRTRGVGSS 243 >05_01_0260 - 1993075-1994312,1996249-1997191 Length = 726 Score = 28.3 bits (60), Expect = 2.4 Identities = 16/51 (31%), Positives = 23/51 (45%), Gaps = 1/51 (1%) Frame = +1 Query: 13 DRVVTTLIRDVDQDQAFY-KTVEMYQFEANDLITKMIEEKNHAGGQNVYGA 162 DR R + + Q F T+ YQF NDL++ + GG + GA Sbjct: 208 DRTTPRSYRVLSRAQVFILPTINSYQFNTNDLVSSSWMNTSSIGGTLLRGA 258 >08_02_1372 + 26500093-26500154,26500733-26500933,26501858-26501936, 26502652-26502752,26503417-26503516,26503893-26503934, 26504026-26504067,26504352-26504509,26504708-26504780 Length = 285 Score = 27.1 bits (57), Expect = 5.6 Identities = 14/38 (36%), Positives = 20/38 (52%) Frame = +1 Query: 43 VDQDQAFYKTVEMYQFEANDLITKMIEEKNHAGGQNVY 156 VDQ + +M EAN + + +EE NH GQ V+ Sbjct: 186 VDQLTELQRKEQMVS-EANRCLRRKLEESNHVRGQQVW 222 Database: rice Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 6,844,203 Number of Sequences: 37544 Number of extensions: 91236 Number of successful extensions: 203 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 201 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 203 length of database: 14,793,348 effective HSP length: 75 effective length of database: 11,977,548 effective search space used: 706675332 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -