BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= S06A01NCLL0001_O07 (380 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_45389| Best HMM Match : Peptidase_M13 (HMM E-Value=4.1e-09) 31 0.42 SB_4321| Best HMM Match : Ank (HMM E-Value=0) 28 2.2 SB_45328| Best HMM Match : DUF1162 (HMM E-Value=6.1e-09) 27 3.9 SB_34845| Best HMM Match : CXC (HMM E-Value=0.03) 27 6.8 >SB_45389| Best HMM Match : Peptidase_M13 (HMM E-Value=4.1e-09) Length = 177 Score = 30.7 bits (66), Expect = 0.42 Identities = 17/40 (42%), Positives = 22/40 (55%) Frame = +2 Query: 221 LEAGRICCNKYLVKNCGKDQFHIRMRLHPFHVIRINKMLS 340 L I C Y KN +D +RM +HP H IRIN ++S Sbjct: 115 LSYAHIFCGSYS-KNAAEDI--VRMSVHPLHPIRINGVVS 151 >SB_4321| Best HMM Match : Ank (HMM E-Value=0) Length = 915 Score = 28.3 bits (60), Expect = 2.2 Identities = 17/62 (27%), Positives = 26/62 (41%) Frame = +2 Query: 56 RYCKNKPYPKSRFCRGVPDPKIRIFDLGKKRATVDDFPLCVHLVSDEYEQLSSEALEAGR 235 R CK K ++R C+G + R+ K D+ +C SDE E + R Sbjct: 444 RMCKGKGRDETRMCKGEGTDETRMC----KSEGTDETRMCKDEGSDETRMCKDEGTDETR 499 Query: 236 IC 241 +C Sbjct: 500 MC 501 >SB_45328| Best HMM Match : DUF1162 (HMM E-Value=6.1e-09) Length = 1508 Score = 27.5 bits (58), Expect = 3.9 Identities = 23/79 (29%), Positives = 36/79 (45%), Gaps = 4/79 (5%) Frame = -1 Query: 248 CC--NRYGLLPAPQNSAARTHQTLSARIVGSHPLSLSFCPSRKYGSLG--QAHPDKTEI* 81 CC N G L + ++ A + S + SH + C R Y S+G Q+H D + Sbjct: 1017 CCRVNSVGRLQSHEDGATVCCRVYSVGRLQSHEDGATVC-CRVY-SVGRLQSHEDGATVC 1074 Query: 80 DTVYSYNIDNISLVGAPLC 24 VYS N + +V + +C Sbjct: 1075 WRVYSVNFSRMKMVRSSVC 1093 >SB_34845| Best HMM Match : CXC (HMM E-Value=0.03) Length = 1397 Score = 26.6 bits (56), Expect = 6.8 Identities = 15/45 (33%), Positives = 21/45 (46%), Gaps = 1/45 (2%) Frame = +2 Query: 155 VDDFPLCVHLVSDEYEQLSSEALEAGRICCNKYLVKNCGKD-QFH 286 +D P C VS YE + + R C K L ++C D +FH Sbjct: 1061 LDPTPECTERVSKTYESGHTLSTATARQQCLKELKESCNDDLEFH 1105 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 13,328,166 Number of Sequences: 59808 Number of extensions: 280848 Number of successful extensions: 918 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 845 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 918 length of database: 16,821,457 effective HSP length: 74 effective length of database: 12,395,665 effective search space used: 644574580 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -