BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= S06A01NCLL0001_O07 (380 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At1g66580.1 68414.m07565 60S ribosomal protein L10 (RPL10C) cont... 209 4e-55 At1g14320.1 68414.m01697 60S ribosomal protein L10 (RPL10A) / Wi... 209 4e-55 At1g26910.1 68414.m03281 60S ribosomal protein L10 (RPL10B) Near... 209 5e-55 At1g53180.1 68414.m06027 expressed protein 31 0.34 At4g20380.3 68417.m02976 zinc finger protein (LSD1) identical to... 29 1.0 At4g20380.2 68417.m02974 zinc finger protein (LSD1) identical to... 29 1.0 At4g20380.1 68417.m02975 zinc finger protein (LSD1) identical to... 29 1.0 At4g02180.1 68417.m00290 DC1 domain-containing protein contains ... 29 1.4 At5g24280.1 68418.m02856 expressed protein ; expression supporte... 28 1.8 At5g10650.1 68418.m01233 zinc finger (C3HC4-type RING finger) fa... 28 1.8 At2g01600.1 68415.m00084 epsin N-terminal homology (ENTH) domain... 28 1.8 At5g55800.1 68418.m06954 DC1 domain-containing protein contains ... 28 2.4 At5g02360.1 68418.m00159 DC1 domain-containing protein contains ... 27 3.2 At5g46660.1 68418.m05749 CHP-rich zinc finger protein, putative ... 27 4.2 At3g15115.1 68416.m01912 expressed protein 27 4.2 At4g12430.1 68417.m01967 trehalose-6-phosphate phosphatase, puta... 27 5.6 At2g41400.1 68415.m05109 expressed protein 27 5.6 At1g19510.1 68414.m02430 myb family transcription factor contain... 27 5.6 At4g36080.1 68417.m05136 FAT domain-containing protein / phospha... 26 7.4 At4g30110.1 68417.m04281 ATPase E1-E2 type family protein / halo... 26 7.4 At3g59190.1 68416.m06599 F-box family protein contains F-box dom... 26 7.4 At3g27670.1 68416.m03455 expressed protein 26 7.4 At3g26550.1 68416.m03314 DC1 domain-containing protein contains ... 26 7.4 At4g20110.1 68417.m02943 vacuolar sorting receptor, putative sim... 26 9.7 At4g16320.1 68417.m02474 expressed protein ; expression supporte... 26 9.7 At4g15236.1 68417.m02335 ABC transporter family protein similar ... 26 9.7 At2g17930.1 68415.m02076 FAT domain-containing protein / phospha... 26 9.7 At1g09900.1 68414.m01114 pentatricopeptide (PPR) repeat-containi... 26 9.7 >At1g66580.1 68414.m07565 60S ribosomal protein L10 (RPL10C) contains Pfam profile: PF00826: Ribosomal L10 Length = 221 Score = 209 bits (511), Expect = 4e-55 Identities = 92/117 (78%), Positives = 103/117 (88%) Frame = +2 Query: 29 MGRRPARCYRYCKNKPYPKSRFCRGVPDPKIRIFDLGKKRATVDDFPLCVHLVSDEYEQL 208 MGRRPARCYR K KPYPKSR+CRGVPDPKIRI+D+G KR VD+FP CVHLVS E E + Sbjct: 1 MGRRPARCYRQIKGKPYPKSRYCRGVPDPKIRIYDVGMKRKGVDEFPFCVHLVSWEKENV 60 Query: 209 SSEALEAGRICCNKYLVKNCGKDQFHIRMRLHPFHVIRINKMLSCAGADRLQTGMRG 379 SSEALEA RI CNKY+VK+ GKD FH+R+R+HPFHV+RINKMLSCAGADRLQTGMRG Sbjct: 61 SSEALEAARIACNKYMVKSAGKDAFHLRIRVHPFHVLRINKMLSCAGADRLQTGMRG 117 >At1g14320.1 68414.m01697 60S ribosomal protein L10 (RPL10A) / Wilm's tumor suppressor protein-related similar to tumor suppressor GI:575354 from [Oryza sativa] Length = 220 Score = 209 bits (511), Expect = 4e-55 Identities = 92/117 (78%), Positives = 103/117 (88%) Frame = +2 Query: 29 MGRRPARCYRYCKNKPYPKSRFCRGVPDPKIRIFDLGKKRATVDDFPLCVHLVSDEYEQL 208 MGRRPARCYR K KPYPKSR+CRGVPDPKIRI+D+G KR VD+FP CVHLVS E E + Sbjct: 1 MGRRPARCYRQIKGKPYPKSRYCRGVPDPKIRIYDVGMKRKGVDEFPFCVHLVSWEKENV 60 Query: 209 SSEALEAGRICCNKYLVKNCGKDQFHIRMRLHPFHVIRINKMLSCAGADRLQTGMRG 379 SSEALEA RI CNKY+VK+ GKD FH+R+R+HPFHV+RINKMLSCAGADRLQTGMRG Sbjct: 61 SSEALEAARIACNKYMVKSAGKDAFHLRIRVHPFHVLRINKMLSCAGADRLQTGMRG 117 >At1g26910.1 68414.m03281 60S ribosomal protein L10 (RPL10B) Nearly identical to ribosomal protein L10.e, Wilm's tumor suppressor homologue, gi|17682 (Z15157), however differences in sequence indicate this is a different member of the L10 family Length = 221 Score = 209 bits (510), Expect = 5e-55 Identities = 92/117 (78%), Positives = 103/117 (88%) Frame = +2 Query: 29 MGRRPARCYRYCKNKPYPKSRFCRGVPDPKIRIFDLGKKRATVDDFPLCVHLVSDEYEQL 208 MGRRPARCYR K KPYPKSR+CRGVPDPKIRI+D+G KR VD+FP CVHLVS E E + Sbjct: 1 MGRRPARCYRQIKGKPYPKSRYCRGVPDPKIRIYDVGMKRKGVDEFPYCVHLVSWEKENV 60 Query: 209 SSEALEAGRICCNKYLVKNCGKDQFHIRMRLHPFHVIRINKMLSCAGADRLQTGMRG 379 SSEALEA RI CNKY+VK+ GKD FH+R+R+HPFHV+RINKMLSCAGADRLQTGMRG Sbjct: 61 SSEALEAARIACNKYMVKSAGKDAFHLRIRVHPFHVLRINKMLSCAGADRLQTGMRG 117 >At1g53180.1 68414.m06027 expressed protein Length = 358 Score = 30.7 bits (66), Expect = 0.34 Identities = 18/43 (41%), Positives = 23/43 (53%) Frame = +2 Query: 14 FVENTMGRRPARCYRYCKNKPYPKSRFCRGVPDPKIRIFDLGK 142 F EN RR +R RYC + PYP S P+ K+ D+GK Sbjct: 20 FFENLFTRR-SRGLRYCHSDPYPSSSSTSTSPE-KMGDSDIGK 60 >At4g20380.3 68417.m02976 zinc finger protein (LSD1) identical to zinc-finger protein Lsd1 [Arabidopsis thaliana] gi|1872521|gb|AAC49660 Length = 184 Score = 29.1 bits (62), Expect = 1.0 Identities = 17/52 (32%), Positives = 24/52 (46%), Gaps = 4/52 (7%) Frame = -1 Query: 302 VVSSGCGTDLY----RSSLRGTCCNRYGLLPAPQNSAARTHQTLSARIVGSH 159 ++ GC T L SS+R +CC L+PA N A + A+I H Sbjct: 46 IICGGCRTMLMYTRGASSVRCSCCQTTNLVPAHSNQVAHAPSSQVAQINCGH 97 >At4g20380.2 68417.m02974 zinc finger protein (LSD1) identical to zinc-finger protein Lsd1 [Arabidopsis thaliana] gi|1872521|gb|AAC49660 Length = 189 Score = 29.1 bits (62), Expect = 1.0 Identities = 17/52 (32%), Positives = 24/52 (46%), Gaps = 4/52 (7%) Frame = -1 Query: 302 VVSSGCGTDLY----RSSLRGTCCNRYGLLPAPQNSAARTHQTLSARIVGSH 159 ++ GC T L SS+R +CC L+PA N A + A+I H Sbjct: 51 IICGGCRTMLMYTRGASSVRCSCCQTTNLVPAHSNQVAHAPSSQVAQINCGH 102 >At4g20380.1 68417.m02975 zinc finger protein (LSD1) identical to zinc-finger protein Lsd1 [Arabidopsis thaliana] gi|1872521|gb|AAC49660 Length = 184 Score = 29.1 bits (62), Expect = 1.0 Identities = 17/52 (32%), Positives = 24/52 (46%), Gaps = 4/52 (7%) Frame = -1 Query: 302 VVSSGCGTDLY----RSSLRGTCCNRYGLLPAPQNSAARTHQTLSARIVGSH 159 ++ GC T L SS+R +CC L+PA N A + A+I H Sbjct: 46 IICGGCRTMLMYTRGASSVRCSCCQTTNLVPAHSNQVAHAPSSQVAQINCGH 97 >At4g02180.1 68417.m00290 DC1 domain-containing protein contains Pfam profile PF03107: DC1 domain Length = 989 Score = 28.7 bits (61), Expect = 1.4 Identities = 13/46 (28%), Positives = 22/46 (47%), Gaps = 2/46 (4%) Frame = +2 Query: 212 SEALEAGRIC--CNKYLVKNCGKDQFHIRMRLHPFHVIRINKMLSC 343 S+A+ G C C+ + K CG+ I+ HP H +++ C Sbjct: 65 SKAVSVGYYCKSCDFFAHKKCGESSEFIQHPSHPNHTLQLRSSEGC 110 Score = 27.1 bits (57), Expect = 4.2 Identities = 13/43 (30%), Positives = 22/43 (51%), Gaps = 2/43 (4%) Frame = +2 Query: 209 SSEALEAGRIC--CNKYLVKNCGKDQFHIRMRLHPFHVIRINK 331 S E++ G C C+ ++ K CG+ I HP H + +N+ Sbjct: 369 SLESVTDGFYCKSCDIFIHKKCGESSGIIDHSSHPDHTLELNR 411 >At5g24280.1 68418.m02856 expressed protein ; expression supported by MPSS Length = 1634 Score = 28.3 bits (60), Expect = 1.8 Identities = 12/24 (50%), Positives = 15/24 (62%) Frame = +2 Query: 188 SDEYEQLSSEALEAGRICCNKYLV 259 SDEY + SEA GR N++LV Sbjct: 1431 SDEYRKFQSEAASLGRSITNRFLV 1454 >At5g10650.1 68418.m01233 zinc finger (C3HC4-type RING finger) family protein similar to Pfam domain, PF00097: Zinc finger, C3HC4 type (RING finger) Length = 525 Score = 28.3 bits (60), Expect = 1.8 Identities = 11/17 (64%), Positives = 12/17 (70%) Frame = -1 Query: 152 SLSFCPSRKYGSLGQAH 102 SLSFCPS Y S G+ H Sbjct: 327 SLSFCPSNIYSSTGRVH 343 >At2g01600.1 68415.m00084 epsin N-terminal homology (ENTH) domain-containing protein contains Pfam PF01417: ENTH domain. ENTH (Epsin N-terminal homology) domain; similar to clathrin assembly protein AP180 (GI:6492344) [Xenopus laevis] Length = 571 Score = 28.3 bits (60), Expect = 1.8 Identities = 19/49 (38%), Positives = 27/49 (55%), Gaps = 2/49 (4%) Frame = -2 Query: 376 THPSLEPISSSARQHFIDADDMEGV*S-HPDVELIFTA-VLYEVLVATD 236 T PS P S+ Q+FID DD+ G+ + PD +I L +V+TD Sbjct: 358 TEPSPPPPPSANAQNFIDTDDLWGLNTGAPDTSVIEDQNALALAIVSTD 406 >At5g55800.1 68418.m06954 DC1 domain-containing protein contains Pfam profile PF03107: DC1 domain Length = 578 Score = 27.9 bits (59), Expect = 2.4 Identities = 11/30 (36%), Positives = 15/30 (50%) Frame = +2 Query: 236 ICCNKYLVKNCGKDQFHIRMRLHPFHVIRI 325 + C K K C + F I HPFH +R+ Sbjct: 107 LICEKMFHKECVESPFEIIHPSHPFHSLRL 136 >At5g02360.1 68418.m00159 DC1 domain-containing protein contains Pfam profile PF03107: DC1 domain Length = 342 Score = 27.5 bits (58), Expect = 3.2 Identities = 16/60 (26%), Positives = 28/60 (46%), Gaps = 2/60 (3%) Frame = +2 Query: 140 KKRATVDDFPLCVHLVSDEYEQLSSEALEAGRICCNKYLVKNCG--KDQFHIRMRLHPFH 313 KK + PL + +++ EYE GR CCN ++CG + ++ + P+H Sbjct: 255 KKHHALRPHPLTLTVITSEYEG------NVGRFCCNACQRESCGFVYEDLGAKIGVLPYH 308 >At5g46660.1 68418.m05749 CHP-rich zinc finger protein, putative contains similarity to CHP-rich zinc finger protein Length = 305 Score = 27.1 bits (57), Expect = 4.2 Identities = 11/32 (34%), Positives = 15/32 (46%) Frame = +2 Query: 242 CNKYLVKNCGKDQFHIRMRLHPFHVIRINKML 337 C K K C + I+ HPFH +R+ L Sbjct: 143 CQKNFHKECVQSPLEIKHPSHPFHSLRLYSYL 174 >At3g15115.1 68416.m01912 expressed protein Length = 339 Score = 27.1 bits (57), Expect = 4.2 Identities = 11/23 (47%), Positives = 15/23 (65%) Frame = +2 Query: 14 FVENTMGRRPARCYRYCKNKPYP 82 F +N + RR +R RYC + PYP Sbjct: 26 FFDNLLDRR-SRILRYCHSDPYP 47 >At4g12430.1 68417.m01967 trehalose-6-phosphate phosphatase, putative similar to trehalose-6-phosphate phosphatase (AtTPPB) [Arabidopsis thaliana] GI:2944180; contains Pfam profile PF02358: Trehalose-phosphatase Length = 368 Score = 26.6 bits (56), Expect = 5.6 Identities = 12/37 (32%), Positives = 20/37 (54%) Frame = -1 Query: 371 SQSGAYQLQRTTTFY*CG*HGRGVVSSGCGTDLYRSS 261 S+ YQL T Y G HG +++S G + ++S+ Sbjct: 151 SRDKVYQLVGLTELYYAGSHGMDIMTSSDGPNCFKST 187 >At2g41400.1 68415.m05109 expressed protein Length = 150 Score = 26.6 bits (56), Expect = 5.6 Identities = 10/23 (43%), Positives = 14/23 (60%) Frame = -1 Query: 74 VYSYNIDNISLVGAPLCSPQSDP 6 ++SY ID +S+ G CS DP Sbjct: 26 LWSYTIDRVSIRGVVYCSLDGDP 48 >At1g19510.1 68414.m02430 myb family transcription factor contains PFAM profile: PF00249 myb-like DNA binding domain Length = 100 Score = 26.6 bits (56), Expect = 5.6 Identities = 11/23 (47%), Positives = 14/23 (60%) Frame = +2 Query: 104 VPDPKIRIFDLGKKRATVDDFPL 172 VP PK + D+G K +DDF L Sbjct: 69 VPLPKYKTVDVGSKSRGIDDFDL 91 >At4g36080.1 68417.m05136 FAT domain-containing protein / phosphatidylinositol 3- and 4-kinase family protein contains Pfam profiles PF00454: Phosphatidylinositol 3- and 4-kinase, PF02259: FAT domain, PF02260: FATC domain Length = 3839 Score = 26.2 bits (55), Expect = 7.4 Identities = 15/35 (42%), Positives = 18/35 (51%) Frame = -2 Query: 280 LIFTAVLYEVLVATDTACFQRLRTQLLVLIRH*VH 176 LI T + VLV T ACF+ LR L+ VH Sbjct: 321 LIDTLLEERVLVGTGRACFESLRPLAYSLLAEIVH 355 >At4g30110.1 68417.m04281 ATPase E1-E2 type family protein / haloacid dehalogenase-like hydrolase family protein / heavy-metal-associated domain-containing protein similar to cadmium efflux pump protein from Geobacillus stearothermophilus [GI:16753175], cadmium resistance protein B from Staphylococcus aureus [GI:14020985] Length = 951 Score = 26.2 bits (55), Expect = 7.4 Identities = 10/28 (35%), Positives = 12/28 (42%) Frame = +2 Query: 209 SSEALEAGRICCNKYLVKNCGKDQFHIR 292 S E G CC Y ++C D H R Sbjct: 911 SRERCHHGSNCCRSYAKESCSHDHHHTR 938 >At3g59190.1 68416.m06599 F-box family protein contains F-box domain Pfam:PF00646 Length = 388 Score = 26.2 bits (55), Expect = 7.4 Identities = 17/36 (47%), Positives = 18/36 (50%) Frame = +2 Query: 143 KRATVDDFPLCVHLVSDEYEQLSSEALEAGRICCNK 250 K A DF + V V Y LSSEALE CC K Sbjct: 297 KGANAADFMMGVCNVKTMY--LSSEALEVLTFCCKK 330 >At3g27670.1 68416.m03455 expressed protein Length = 1841 Score = 26.2 bits (55), Expect = 7.4 Identities = 12/30 (40%), Positives = 17/30 (56%) Frame = -2 Query: 340 RQHFIDADDMEGV*SHPDVELIFTAVLYEV 251 RQ IDA ++ V SHP +IF +L + Sbjct: 1704 RQWLIDAVEISCVSSHPSTAIIFVGLLSSI 1733 >At3g26550.1 68416.m03314 DC1 domain-containing protein contains Pfam profile PF03107: DC1 domain Length = 681 Score = 26.2 bits (55), Expect = 7.4 Identities = 14/42 (33%), Positives = 21/42 (50%) Frame = +2 Query: 200 EQLSSEALEAGRICCNKYLVKNCGKDQFHIRMRLHPFHVIRI 325 E +S + A C NK+ K C + I+ HPFH +R+ Sbjct: 130 ESKTSRSYYACLECGNKFH-KQCVESPLEIKHPSHPFHSLRL 170 >At4g20110.1 68417.m02943 vacuolar sorting receptor, putative similar to BP-80 vacuolar sorting receptor [Pisum sativum] GI:1737222; identical to vacuolar sorting receptor-like protein (GI:2827665) [Arabidopsis thaliana] Length = 625 Score = 25.8 bits (54), Expect = 9.7 Identities = 14/46 (30%), Positives = 22/46 (47%) Frame = +2 Query: 59 YCKNKPYPKSRFCRGVPDPKIRIFDLGKKRATVDDFPLCVHLVSDE 196 +CK++ R+C P+ R GK + LCVH V++E Sbjct: 248 HCKSQCINHGRYCAPDPEDNFREGYEGKDVVLENLRQLCVHRVANE 293 >At4g16320.1 68417.m02474 expressed protein ; expression supported by MPSS Length = 279 Score = 25.8 bits (54), Expect = 9.7 Identities = 11/26 (42%), Positives = 16/26 (61%) Frame = -3 Query: 375 RIPVWSLSAPAHDNILLMRMTWKGCS 298 RIPV + S P+H N L+ ++ CS Sbjct: 48 RIPVDNYSQPSHSNELVSHSKFRECS 73 >At4g15236.1 68417.m02335 ABC transporter family protein similar to pleiotropic drug resistance like protein [Nicotiana tabacum] GI:20522008, ABC1 protein [Nicotiana plumbaginifolia] GI:14331118; contains Pfam profile PF00005: ABC transporter Length = 1388 Score = 25.8 bits (54), Expect = 9.7 Identities = 12/28 (42%), Positives = 18/28 (64%) Frame = +1 Query: 211 F*GAGSRPYLLQQVPRKELR*RSVPHPD 294 F GAGSR +++++ R+E VP PD Sbjct: 237 FQGAGSRLEMMKEISRREKLKGIVPDPD 264 >At2g17930.1 68415.m02076 FAT domain-containing protein / phosphatidylinositol 3- and 4-kinase family protein contains Pfam profiles PF02259 FAT domain, PF00454 Phosphatidylinositol 3- and 4-kinase, PF02260: FATC domain Length = 3795 Score = 25.8 bits (54), Expect = 9.7 Identities = 15/35 (42%), Positives = 18/35 (51%) Frame = -2 Query: 280 LIFTAVLYEVLVATDTACFQRLRTQLLVLIRH*VH 176 LI T + VLV T ACF+ LR L+ VH Sbjct: 279 LIDTLLDERVLVGTGRACFESLRPLAYSLLAEIVH 313 >At1g09900.1 68414.m01114 pentatricopeptide (PPR) repeat-containing protein contains Pfam profile PF01535: PPR repeat Length = 598 Score = 25.8 bits (54), Expect = 9.7 Identities = 12/28 (42%), Positives = 16/28 (57%) Frame = +2 Query: 197 YEQLSSEALEAGRICCNKYLVKNCGKDQ 280 YE ++ EALE CNK L+K +Q Sbjct: 566 YEGMAKEALELLNELCNKGLMKKSSAEQ 593 Database: arabidopsis Posted date: Oct 4, 2007 10:56 AM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 9,112,653 Number of Sequences: 28952 Number of extensions: 184943 Number of successful extensions: 553 Number of sequences better than 10.0: 28 Number of HSP's better than 10.0 without gapping: 544 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 553 length of database: 12,070,560 effective HSP length: 73 effective length of database: 9,957,064 effective search space used: 527724392 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -