BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= S06A01NCLL0001_O04 (363 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value AB231585-1|BAE17127.1| 898|Apis mellifera Mahya protein. 27 0.068 AF213012-1|AAG43568.1| 492|Apis mellifera acetylcholinesterase ... 25 0.21 AB181702-1|BAE06051.1| 628|Apis mellifera acetylcholinesterase ... 25 0.21 AB167961-1|BAD51404.1| 554|Apis mellifera E74 protein. 25 0.36 DQ325121-1|ABD14135.1| 181|Apis mellifera complementary sex det... 21 4.5 DQ325120-1|ABD14134.1| 181|Apis mellifera complementary sex det... 21 4.5 DQ325119-1|ABD14133.1| 181|Apis mellifera complementary sex det... 21 4.5 DQ325118-1|ABD14132.1| 181|Apis mellifera complementary sex det... 21 4.5 DQ325117-1|ABD14131.1| 181|Apis mellifera complementary sex det... 21 4.5 DQ325116-1|ABD14130.1| 181|Apis mellifera complementary sex det... 21 4.5 DQ325114-1|ABD14128.1| 181|Apis mellifera complementary sex det... 21 4.5 AB244761-1|BAE66603.1| 504|Apis mellifera cystathionine beta-sy... 21 4.5 DQ325077-1|ABD14091.1| 181|Apis mellifera complementary sex det... 21 5.9 DQ325076-1|ABD14090.1| 191|Apis mellifera complementary sex det... 21 5.9 AY569704-1|AAS86657.1| 426|Apis mellifera complementary sex det... 21 5.9 EF540769-1|ABQ14707.1| 620|Apis mellifera adenosine deaminase p... 20 7.8 DQ026032-1|AAY87891.1| 566|Apis mellifera nicotinic acetylcholi... 20 7.8 AB253415-1|BAE86926.1| 588|Apis mellifera alpha-glucosidase pro... 20 7.8 >AB231585-1|BAE17127.1| 898|Apis mellifera Mahya protein. Length = 898 Score = 27.1 bits (57), Expect = 0.068 Identities = 10/28 (35%), Positives = 16/28 (57%) Frame = +1 Query: 277 LVVHRVPDGRVCASFHRERFQEPARHRC 360 L +H +P+ +V F +R +E A RC Sbjct: 396 LTIHTIPEVKVTPRFQAKRLKEEANIRC 423 >AF213012-1|AAG43568.1| 492|Apis mellifera acetylcholinesterase protein. Length = 492 Score = 25.4 bits (53), Expect = 0.21 Identities = 15/38 (39%), Positives = 21/38 (55%) Frame = +2 Query: 92 GDKVGASEATLLNMLNISPFSYGLVVKQVYDSGTIFAP 205 G+ G S +L ISP + GLV + + SGT+ AP Sbjct: 251 GESAGGSSVSLHL---ISPVTRGLVRRGILQSGTLNAP 285 >AB181702-1|BAE06051.1| 628|Apis mellifera acetylcholinesterase protein. Length = 628 Score = 25.4 bits (53), Expect = 0.21 Identities = 15/38 (39%), Positives = 21/38 (55%) Frame = +2 Query: 92 GDKVGASEATLLNMLNISPFSYGLVVKQVYDSGTIFAP 205 G+ G S +L ISP + GLV + + SGT+ AP Sbjct: 251 GESAGGSSVSLHL---ISPVTRGLVRRGILQSGTLNAP 285 >AB167961-1|BAD51404.1| 554|Apis mellifera E74 protein. Length = 554 Score = 24.6 bits (51), Expect = 0.36 Identities = 8/10 (80%), Positives = 9/10 (90%) Frame = +1 Query: 7 GFLPGSFHPH 36 GFLP S+HPH Sbjct: 310 GFLPPSYHPH 319 >DQ325121-1|ABD14135.1| 181|Apis mellifera complementary sex determiner protein. Length = 181 Score = 21.0 bits (42), Expect = 4.5 Identities = 8/18 (44%), Positives = 11/18 (61%) Frame = -2 Query: 191 YRSRTPV*QQDHTKRERC 138 YR + +D T+RERC Sbjct: 59 YRETSKERSRDRTERERC 76 >DQ325120-1|ABD14134.1| 181|Apis mellifera complementary sex determiner protein. Length = 181 Score = 21.0 bits (42), Expect = 4.5 Identities = 8/18 (44%), Positives = 11/18 (61%) Frame = -2 Query: 191 YRSRTPV*QQDHTKRERC 138 YR + +D T+RERC Sbjct: 59 YRETSKERSRDRTERERC 76 >DQ325119-1|ABD14133.1| 181|Apis mellifera complementary sex determiner protein. Length = 181 Score = 21.0 bits (42), Expect = 4.5 Identities = 8/18 (44%), Positives = 11/18 (61%) Frame = -2 Query: 191 YRSRTPV*QQDHTKRERC 138 YR + +D T+RERC Sbjct: 59 YRETSKERSRDRTERERC 76 >DQ325118-1|ABD14132.1| 181|Apis mellifera complementary sex determiner protein. Length = 181 Score = 21.0 bits (42), Expect = 4.5 Identities = 8/18 (44%), Positives = 11/18 (61%) Frame = -2 Query: 191 YRSRTPV*QQDHTKRERC 138 YR + +D T+RERC Sbjct: 59 YRETSKERSRDRTERERC 76 >DQ325117-1|ABD14131.1| 181|Apis mellifera complementary sex determiner protein. Length = 181 Score = 21.0 bits (42), Expect = 4.5 Identities = 8/18 (44%), Positives = 11/18 (61%) Frame = -2 Query: 191 YRSRTPV*QQDHTKRERC 138 YR + +D T+RERC Sbjct: 59 YRETSKERSRDRTERERC 76 >DQ325116-1|ABD14130.1| 181|Apis mellifera complementary sex determiner protein. Length = 181 Score = 21.0 bits (42), Expect = 4.5 Identities = 8/18 (44%), Positives = 11/18 (61%) Frame = -2 Query: 191 YRSRTPV*QQDHTKRERC 138 YR + +D T+RERC Sbjct: 59 YRETSKERSRDRTERERC 76 >DQ325114-1|ABD14128.1| 181|Apis mellifera complementary sex determiner protein. Length = 181 Score = 21.0 bits (42), Expect = 4.5 Identities = 8/18 (44%), Positives = 11/18 (61%) Frame = -2 Query: 191 YRSRTPV*QQDHTKRERC 138 YR + +D T+RERC Sbjct: 59 YRETSKERSRDRTERERC 76 >AB244761-1|BAE66603.1| 504|Apis mellifera cystathionine beta-synthase protein. Length = 504 Score = 21.0 bits (42), Expect = 4.5 Identities = 11/25 (44%), Positives = 14/25 (56%) Frame = +2 Query: 56 IEIINDVHILKPGDKVGASEATLLN 130 I I+N HIL+ K G S L+N Sbjct: 480 IGIVNQFHILQFITKNGTSNNYLIN 504 >DQ325077-1|ABD14091.1| 181|Apis mellifera complementary sex determiner protein. Length = 181 Score = 20.6 bits (41), Expect = 5.9 Identities = 9/19 (47%), Positives = 12/19 (63%) Frame = -2 Query: 197 RWYRSRTPV*QQDHTKRER 141 R YR R+ +D T+RER Sbjct: 57 RKYRERSKERSRDRTERER 75 >DQ325076-1|ABD14090.1| 191|Apis mellifera complementary sex determiner protein. Length = 191 Score = 20.6 bits (41), Expect = 5.9 Identities = 9/19 (47%), Positives = 12/19 (63%) Frame = -2 Query: 197 RWYRSRTPV*QQDHTKRER 141 R YR R+ +D T+RER Sbjct: 57 RKYRERSKERSRDRTERER 75 >AY569704-1|AAS86657.1| 426|Apis mellifera complementary sex determiner protein. Length = 426 Score = 20.6 bits (41), Expect = 5.9 Identities = 9/19 (47%), Positives = 12/19 (63%) Frame = -2 Query: 197 RWYRSRTPV*QQDHTKRER 141 R YR R+ +D T+RER Sbjct: 290 RKYRERSKERSRDRTERER 308 >EF540769-1|ABQ14707.1| 620|Apis mellifera adenosine deaminase protein. Length = 620 Score = 20.2 bits (40), Expect = 7.8 Identities = 7/17 (41%), Positives = 11/17 (64%) Frame = +2 Query: 209 ILDIKPEDLREKFLAGV 259 ++ KP+ R K LAG+ Sbjct: 266 LIQSKPQHARRKVLAGI 282 >DQ026032-1|AAY87891.1| 566|Apis mellifera nicotinic acetylcholine receptor alpha3subunit protein. Length = 566 Score = 20.2 bits (40), Expect = 7.8 Identities = 8/10 (80%), Positives = 8/10 (80%) Frame = -2 Query: 161 DHTKRERCST 132 DHTKRE ST Sbjct: 491 DHTKREEDST 500 >AB253415-1|BAE86926.1| 588|Apis mellifera alpha-glucosidase protein. Length = 588 Score = 20.2 bits (40), Expect = 7.8 Identities = 10/30 (33%), Positives = 17/30 (56%) Frame = -3 Query: 202 REDGTGVVHLFDNKTIRKGRDVQHVEKSSF 113 ++D HL+ N T + RDV ++K +F Sbjct: 455 KKDSISHYHLYTNLTALRKRDV--LKKGNF 482 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 100,346 Number of Sequences: 438 Number of extensions: 2201 Number of successful extensions: 28 Number of sequences better than 10.0: 18 Number of HSP's better than 10.0 without gapping: 28 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 28 length of database: 146,343 effective HSP length: 51 effective length of database: 124,005 effective search space used: 8556345 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 39 (20.8 bits)
- SilkBase 1999-2023 -