SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/11/18
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= S06A01NCLL0001_O03
         (461 letters)

Database: bee 
           438 sequences; 146,343 total letters

Searching......................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

AY338499-1|AAR08420.1|  500|Apis mellifera Kruppel-like protein ...    22   3.7  
L01589-1|AAA27736.1|   81|Apis mellifera zinc finger protein pro...    21   4.9  
DQ026037-1|AAY87896.1|  431|Apis mellifera nicotinic acetylcholi...    21   8.5  

>AY338499-1|AAR08420.1|  500|Apis mellifera Kruppel-like protein 1
           protein.
          Length = 500

 Score = 21.8 bits (44), Expect = 3.7
 Identities = 9/30 (30%), Positives = 11/30 (36%)
 Frame = +3

Query: 111 CSSNVMSPGERVAHGRREPARPPYTNTGAG 200
           CS   +  G+ V H R      PY     G
Sbjct: 181 CSKTFIQSGQLVIHMRTHTGEKPYVCKACG 210


>L01589-1|AAA27736.1|   81|Apis mellifera zinc finger protein
           protein.
          Length = 81

 Score = 21.4 bits (43), Expect = 4.9
 Identities = 7/13 (53%), Positives = 9/13 (69%)
 Frame = -3

Query: 273 WILAGRPTTHSGE 235
           W+L G   TH+GE
Sbjct: 56  WLLQGHIRTHTGE 68


>DQ026037-1|AAY87896.1|  431|Apis mellifera nicotinic acetylcholine
           receptor alpha9subunit protein.
          Length = 431

 Score = 20.6 bits (41), Expect = 8.5
 Identities = 7/12 (58%), Positives = 10/12 (83%)
 Frame = +2

Query: 17  TTPMLVYDYDIS 52
           T PM+VY++ IS
Sbjct: 238 TYPMIVYEFSIS 249


  Database: bee
    Posted date:  Oct 23, 2007  1:17 PM
  Number of letters in database: 146,343
  Number of sequences in database:  438
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 124,521
Number of Sequences: 438
Number of extensions: 2786
Number of successful extensions: 3
Number of sequences better than 10.0: 3
Number of HSP's better than 10.0 without gapping: 3
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 3
length of database: 146,343
effective HSP length: 53
effective length of database: 123,129
effective search space used: 12312900
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

- SilkBase 1999-2023 -