BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= S06A01NCLL0001_O03 (461 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At4g12700.1 68417.m01994 expressed protein 29 2.0 At1g01420.1 68414.m00057 UDP-glucoronosyl/UDP-glucosyl transfera... 27 8.2 >At4g12700.1 68417.m01994 expressed protein Length = 561 Score = 28.7 bits (61), Expect = 2.0 Identities = 16/46 (34%), Positives = 22/46 (47%), Gaps = 1/46 (2%) Frame = +3 Query: 66 FYRDSESNYLEYGLNCSSNVMSPGE-RVAHGRREPARPPYTNTGAG 200 FY+D +E NCS +VM GE R+ RP + N+ G Sbjct: 179 FYKDYRRFVIEKSGNCSVSVMGIGEYHSGVNARKRKRPGFRNSSGG 224 >At1g01420.1 68414.m00057 UDP-glucoronosyl/UDP-glucosyl transferase family protein contains Pfam profile: PF00201 UDP-glucoronosyl and UDP-glucosyl transferase Length = 481 Score = 26.6 bits (56), Expect = 8.2 Identities = 12/26 (46%), Positives = 13/26 (50%) Frame = -2 Query: 169 AGSRRPWATRSPGLITFEEQFNPYSR 92 +G R W RSP I FNP SR Sbjct: 296 SGKRFLWVIRSPSGIASSSYFNPQSR 321 Database: arabidopsis Posted date: Oct 4, 2007 10:56 AM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 9,364,382 Number of Sequences: 28952 Number of extensions: 180389 Number of successful extensions: 434 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 428 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 434 length of database: 12,070,560 effective HSP length: 75 effective length of database: 9,899,160 effective search space used: 772134480 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -