BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= S06A01NCLL0001_O02 (394 letters) Database: fruitfly 53,049 sequences; 24,988,368 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AY069549-1|AAL39694.1| 434|Drosophila melanogaster LD27553p pro... 28 3.8 AF017096-1|AAC39085.1| 347|Drosophila melanogaster protein ( Dr... 28 3.8 AE014297-671|AAF54165.2| 434|Drosophila melanogaster CG2678-PA ... 28 3.8 >AY069549-1|AAL39694.1| 434|Drosophila melanogaster LD27553p protein. Length = 434 Score = 28.3 bits (60), Expect = 3.8 Identities = 18/50 (36%), Positives = 24/50 (48%), Gaps = 1/50 (2%) Frame = -3 Query: 332 CI*TYF-KSYRRRKLITKLSQNLTRGFSC*VAFLNVHNFKKRLRDKPGDG 186 C TY KS +R L LS+ + F C AF+ + K+ LR DG Sbjct: 226 CPRTYMQKSNLKRHLRNHLSKPAHKCFHCSKAFMRKDHLKRHLRTHDSDG 275 >AF017096-1|AAC39085.1| 347|Drosophila melanogaster protein ( Drosophila melanogasterprophosphoribosylamidotransferase (Prat) gene, completecds. ). Length = 347 Score = 28.3 bits (60), Expect = 3.8 Identities = 18/50 (36%), Positives = 24/50 (48%), Gaps = 1/50 (2%) Frame = -3 Query: 332 CI*TYF-KSYRRRKLITKLSQNLTRGFSC*VAFLNVHNFKKRLRDKPGDG 186 C TY KS +R L LS+ + F C AF+ + K+ LR DG Sbjct: 227 CPRTYMQKSNLKRHLRNHLSKPAHKCFHCSKAFMRKDHLKRHLRTHDSDG 276 >AE014297-671|AAF54165.2| 434|Drosophila melanogaster CG2678-PA protein. Length = 434 Score = 28.3 bits (60), Expect = 3.8 Identities = 18/50 (36%), Positives = 24/50 (48%), Gaps = 1/50 (2%) Frame = -3 Query: 332 CI*TYF-KSYRRRKLITKLSQNLTRGFSC*VAFLNVHNFKKRLRDKPGDG 186 C TY KS +R L LS+ + F C AF+ + K+ LR DG Sbjct: 226 CPRTYMQKSNLKRHLRNHLSKPAHKCFHCSKAFMRKDHLKRHLRTHDSDG 275 Database: fruitfly Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 24,988,368 Number of sequences in database: 53,049 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 15,627,864 Number of Sequences: 53049 Number of extensions: 270574 Number of successful extensions: 612 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 581 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 612 length of database: 24,988,368 effective HSP length: 77 effective length of database: 20,903,595 effective search space used: 1107890535 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -