BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= S06A01NCLL0001_N24 (441 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value AM292382-1|CAL23194.2| 670|Tribolium castaneum gustatory recept... 20 9.1 AJ518940-1|CAD57734.1| 361|Tribolium castaneum extradenticle pr... 20 9.1 >AM292382-1|CAL23194.2| 670|Tribolium castaneum gustatory receptor candidate 61 protein. Length = 670 Score = 20.2 bits (40), Expect = 9.1 Identities = 7/25 (28%), Positives = 11/25 (44%) Frame = -2 Query: 242 RDRSLVGWMSWPIAKFFVLFSNRGF 168 R S +GW W + + + L F Sbjct: 563 RPISTLGWFFWSLLRIYELARKAAF 587 >AJ518940-1|CAD57734.1| 361|Tribolium castaneum extradenticle protein. Length = 361 Score = 20.2 bits (40), Expect = 9.1 Identities = 12/36 (33%), Positives = 17/36 (47%) Frame = +3 Query: 252 MAEIYSHPASKGCVTASSQSAAANQPVHPDIR*NHS 359 +AE + P G A++ +AA Q PD HS Sbjct: 110 IAEGVAGPEKGGGAGAAASGSAAAQAGQPDNAIEHS 145 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 100,941 Number of Sequences: 336 Number of extensions: 1998 Number of successful extensions: 2 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 2 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 2 length of database: 122,585 effective HSP length: 52 effective length of database: 105,113 effective search space used: 9880622 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 40 (21.2 bits)
- SilkBase 1999-2023 -