BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= S06A01NCLL0001_N24 (441 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At2g47610.1 68415.m05940 60S ribosomal protein L7A (RPL7aA) 122 1e-28 At3g62870.1 68416.m07063 60S ribosomal protein L7A (RPL7aB) 60S ... 120 4e-28 At5g64290.1 68418.m08076 oxoglutarate/malate translocator, putat... 29 1.1 At5g42540.1 68418.m05178 5'-3' exoribonuclease (XRN2) identical ... 26 9.8 At1g27340.1 68414.m03330 F-box family protein contains Pfam PF00... 26 9.8 >At2g47610.1 68415.m05940 60S ribosomal protein L7A (RPL7aA) Length = 257 Score = 122 bits (293), Expect = 1e-28 Identities = 54/89 (60%), Positives = 70/89 (78%) Frame = +1 Query: 175 LFEKRTKNFAIGQDIQPTRDLSRFVRWPKYIRIQRQKAVLQRRLKVPPPINQFTQTLDKT 354 LFE+R K F IG + P +DLSR+++WPK IR+QRQK +L++RLKVPP +NQFT+TLDK Sbjct: 23 LFERRPKQFGIGGALPPKKDLSRYIKWPKSIRLQRQKRILKQRLKVPPALNQFTKTLDKN 82 Query: 355 TAKGLFKILEKYRPETEAVRKERLKKAAE 441 A LFK+L KYRPE +A +KERL K A+ Sbjct: 83 LATSLFKVLLKYRPEDKAAKKERLVKKAQ 111 >At3g62870.1 68416.m07063 60S ribosomal protein L7A (RPL7aB) 60S RIBOSOMAL PROTEIN L7A - Oryza sativa, SWISSPROT:RL7A_ORYSA Length = 256 Score = 120 bits (289), Expect = 4e-28 Identities = 54/89 (60%), Positives = 69/89 (77%) Frame = +1 Query: 175 LFEKRTKNFAIGQDIQPTRDLSRFVRWPKYIRIQRQKAVLQRRLKVPPPINQFTQTLDKT 354 LFE+R K F IG + P +DLSR+++WPK IR+QRQK +L++RLKVPP +NQFT+TLDK Sbjct: 22 LFERRPKQFGIGGALPPKKDLSRYIKWPKSIRLQRQKRILKQRLKVPPALNQFTKTLDKN 81 Query: 355 TAKGLFKILEKYRPETEAVRKERLKKAAE 441 A LFKIL KYRPE +A +KERL A+ Sbjct: 82 LATSLFKILLKYRPEDKAAKKERLLNKAQ 110 >At5g64290.1 68418.m08076 oxoglutarate/malate translocator, putative similar to SWISS-PROT:Q41364 2-oxoglutarate/malate translocator, chloroplast precursor. [Spinach]{Spinacia oleracea} Length = 563 Score = 29.5 bits (63), Expect = 1.1 Identities = 14/30 (46%), Positives = 18/30 (60%) Frame = -2 Query: 416 FLTASVSGLYFSKILNRPLAVVLSNVWVNW 327 FLTA+ L K+ L VV+SN WV+W Sbjct: 280 FLTAAAQNLLCLKLAEE-LGVVISNPWVSW 308 >At5g42540.1 68418.m05178 5'-3' exoribonuclease (XRN2) identical to XRN2 [Arabidopsis thaliana] GI:11875630; contains Pfam domain PF03159: Putative 5'-3' exonuclease domain Length = 1012 Score = 26.2 bits (55), Expect = 9.8 Identities = 10/27 (37%), Positives = 18/27 (66%) Frame = -3 Query: 244 NGIDLWLAGCPGQ*QSSLFSSRIEGLQ 164 +G++ ++A C G Q S F S +EG++ Sbjct: 739 DGMNGYIASCGGDSQPSCFCSTVEGME 765 >At1g27340.1 68414.m03330 F-box family protein contains Pfam PF00646: F-box domain; similar to fim protein; similar to ESTs gb|T42445, gb|T76780, gb|AA650733, and emb|Z17748 Length = 467 Score = 26.2 bits (55), Expect = 9.8 Identities = 10/20 (50%), Positives = 14/20 (70%) Frame = +1 Query: 364 GLFKILEKYRPETEAVRKER 423 G+FK+LE +P + RKER Sbjct: 77 GIFKMLETVKPPVKRTRKER 96 Database: arabidopsis Posted date: Oct 4, 2007 10:56 AM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 9,299,349 Number of Sequences: 28952 Number of extensions: 180801 Number of successful extensions: 505 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 500 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 505 length of database: 12,070,560 effective HSP length: 75 effective length of database: 9,899,160 effective search space used: 702840360 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -