BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= S06A01NCLL0001_N22 (489 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value AY074761-1|AAL71874.1| 314|Tribolium castaneum ultrabithorax pr... 22 3.4 AY675073-1|AAV74190.1| 533|Tribolium castaneum chitinase 5 prot... 21 4.5 AF227923-1|AAF36721.1| 351|Tribolium castaneum abdominal-B prot... 21 6.0 AY295880-2|AAQ62694.1| 1558|Tribolium castaneum chitin synthase ... 21 7.9 AY295880-1|AAQ62693.1| 1558|Tribolium castaneum chitin synthase ... 21 7.9 AY291476-1|AAQ55060.1| 1558|Tribolium castaneum chitin synthase ... 21 7.9 AY291475-1|AAQ55059.1| 1558|Tribolium castaneum chitin synthase ... 21 7.9 >AY074761-1|AAL71874.1| 314|Tribolium castaneum ultrabithorax protein. Length = 314 Score = 21.8 bits (44), Expect = 3.4 Identities = 11/30 (36%), Positives = 13/30 (43%) Frame = -3 Query: 187 HHGVYKRTSPSGN*HFPLPNGWSPQAS*SH 98 HH + + FPL G SP AS H Sbjct: 24 HHHEQSAAAAAAYRSFPLSLGMSPYASSQH 53 >AY675073-1|AAV74190.1| 533|Tribolium castaneum chitinase 5 protein. Length = 533 Score = 21.4 bits (43), Expect = 4.5 Identities = 9/25 (36%), Positives = 12/25 (48%) Frame = +1 Query: 121 TTHLGAENVNFQMETYVYKRRGDGT 195 T L N N+ TY+ K G G+ Sbjct: 272 TFTLSNSNTNYNPGTYINKEAGGGS 296 >AF227923-1|AAF36721.1| 351|Tribolium castaneum abdominal-B protein. Length = 351 Score = 21.0 bits (42), Expect = 6.0 Identities = 7/14 (50%), Positives = 9/14 (64%) Frame = -1 Query: 387 VSKCTRSETSSNWC 346 VS C + +SS WC Sbjct: 135 VSSCHQGFSSSTWC 148 >AY295880-2|AAQ62694.1| 1558|Tribolium castaneum chitin synthase variant 2 protein. Length = 1558 Score = 20.6 bits (41), Expect = 7.9 Identities = 7/15 (46%), Positives = 9/15 (60%) Frame = -2 Query: 425 INSLGSRNAAWIWLV 381 +N S AWIWL+ Sbjct: 455 LNDFISHQHAWIWLL 469 >AY295880-1|AAQ62693.1| 1558|Tribolium castaneum chitin synthase variant 1 protein. Length = 1558 Score = 20.6 bits (41), Expect = 7.9 Identities = 7/15 (46%), Positives = 9/15 (60%) Frame = -2 Query: 425 INSLGSRNAAWIWLV 381 +N S AWIWL+ Sbjct: 455 LNDFISHQHAWIWLL 469 >AY291476-1|AAQ55060.1| 1558|Tribolium castaneum chitin synthase CHS1B protein. Length = 1558 Score = 20.6 bits (41), Expect = 7.9 Identities = 7/15 (46%), Positives = 9/15 (60%) Frame = -2 Query: 425 INSLGSRNAAWIWLV 381 +N S AWIWL+ Sbjct: 455 LNDFISHQHAWIWLL 469 >AY291475-1|AAQ55059.1| 1558|Tribolium castaneum chitin synthase CHS1A protein. Length = 1558 Score = 20.6 bits (41), Expect = 7.9 Identities = 7/15 (46%), Positives = 9/15 (60%) Frame = -2 Query: 425 INSLGSRNAAWIWLV 381 +N S AWIWL+ Sbjct: 455 LNDFISHQHAWIWLL 469 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 110,737 Number of Sequences: 336 Number of extensions: 2192 Number of successful extensions: 12 Number of sequences better than 10.0: 7 Number of HSP's better than 10.0 without gapping: 12 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 12 length of database: 122,585 effective HSP length: 53 effective length of database: 104,777 effective search space used: 11420693 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 40 (21.2 bits)
- SilkBase 1999-2023 -