BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= S06A01NCLL0001_N22 (489 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 03_01_0582 - 4318837-4318967,4319219-4319399,4319504-4319701,431... 170 6e-43 07_03_1272 - 25360180-25360286,25360454-25360658,25360748-253609... 167 4e-42 04_04_0157 + 23165638-23166633 28 3.5 >03_01_0582 - 4318837-4318967,4319219-4319399,4319504-4319701, 4319791-4320053,4320453-4320597 Length = 305 Score = 170 bits (413), Expect = 6e-43 Identities = 81/145 (55%), Positives = 99/145 (68%) Frame = +1 Query: 52 ATMSGGLDLLALSEEDVTKMLAATTHLGAENVNFQMETYVYKRRGDGTHVINLRRTWEKX 231 A G L+ +E+DV MLAA HLG +N +FQME YVYKRR DG ++INL +TWEK Sbjct: 3 AVAGGAARALSQAEQDVQMMLAADVHLGTKNCDFQMERYVYKRRSDGIYIINLGKTWEKL 62 Query: 232 XXXXXXXXXXEDPADVFVISSRAFGQRAVLKFAAHTGATPIAGRFTPGAFTNQIQAAFRE 411 E+P D+ V S+R +GQRAVLKFA +TGA IAGR TPG FTNQ+Q +F E Sbjct: 63 QLAARVIVAIENPQDIIVQSARPYGQRAVLKFAQYTGAHAIAGRHTPGTFTNQLQTSFSE 122 Query: 412 PRLLIV*DPAQDHQPITEASYVNIP 486 PRLLI+ DP DHQPI E++ NIP Sbjct: 123 PRLLILTDPRTDHQPIKESALGNIP 147 >07_03_1272 - 25360180-25360286,25360454-25360658,25360748-25360945, 25361034-25361296,25361865-25362009 Length = 305 Score = 167 bits (406), Expect = 4e-42 Identities = 82/143 (57%), Positives = 99/143 (69%), Gaps = 2/143 (1%) Frame = +1 Query: 64 GGLDLLALS--EEDVTKMLAATTHLGAENVNFQMETYVYKRRGDGTHVINLRRTWEKXXX 237 GG ALS E+D+ MLAA HLG +N +FQME YVYKRR DG ++INL +TWEK Sbjct: 5 GGAAARALSQREQDIQMMLAADVHLGTKNCDFQMERYVYKRRTDGIYIINLGKTWEKLQL 64 Query: 238 XXXXXXXXEDPADVFVISSRAFGQRAVLKFAAHTGATPIAGRFTPGAFTNQIQAAFREPR 417 E+P D+ V S+R +GQRAVLKFA +TGA IAGR TPG FTNQ+Q +F EPR Sbjct: 65 AARVIVAIENPQDIIVQSARPYGQRAVLKFAQYTGAHAIAGRHTPGTFTNQLQTSFSEPR 124 Query: 418 LLIV*DPAQDHQPITEASYVNIP 486 LLI+ DP DHQPI E++ NIP Sbjct: 125 LLILTDPRTDHQPIKESALGNIP 147 >04_04_0157 + 23165638-23166633 Length = 331 Score = 28.3 bits (60), Expect = 3.5 Identities = 10/18 (55%), Positives = 14/18 (77%) Frame = -2 Query: 227 FSHVRRRLITCVPSPRRL 174 FSH+RRRL+ +P+P L Sbjct: 5 FSHLRRRLLAAIPNPNLL 22 Database: rice Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 13,458,228 Number of Sequences: 37544 Number of extensions: 266951 Number of successful extensions: 605 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 597 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 604 length of database: 14,793,348 effective HSP length: 77 effective length of database: 11,902,460 effective search space used: 1011709100 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -