BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= S06A01NCLL0001_N21 (421 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 07_01_0021 - 133549-133628,133780-133824,133850-133858,134513-13... 27 4.6 08_02_1093 - 24271826-24273427 27 6.1 >07_01_0021 - 133549-133628,133780-133824,133850-133858,134513-134656, 140098-140391,141324-141908,142034-142198,142364-142406 Length = 454 Score = 27.5 bits (58), Expect = 4.6 Identities = 15/38 (39%), Positives = 20/38 (52%), Gaps = 2/38 (5%) Frame = -1 Query: 319 GVSSAPE--RTAYTSTVNSALLVYLARNSLIKTSPLCP 212 G SSA + R VN L+ ++ RN L SP+CP Sbjct: 246 GPSSAKQMLRQISNCNVNGVLVFFMLRNCLRFNSPVCP 283 >08_02_1093 - 24271826-24273427 Length = 533 Score = 27.1 bits (57), Expect = 6.1 Identities = 14/30 (46%), Positives = 16/30 (53%) Frame = +3 Query: 300 SGALDTPHGLDARPHRSPQDTDRHVAGAEA 389 +GA + DA PHRS HVAGA A Sbjct: 124 TGAFASQSSYDAAPHRSLSYHGFHVAGAAA 153 Database: rice Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 9,322,712 Number of Sequences: 37544 Number of extensions: 154218 Number of successful extensions: 412 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 397 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 411 length of database: 14,793,348 effective HSP length: 75 effective length of database: 11,977,548 effective search space used: 766563072 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -