BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= S06A01NCLL0001_N21 (421 letters) Database: human 237,096 sequences; 76,859,062 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value U09123-1|AAB60650.1| 341|Homo sapiens hnRNP protein A2 protein. 35 0.13 M29065-1|AAA36574.1| 341|Homo sapiens protein ( Human hnRNP A2 ... 35 0.13 M29064-1|AAA60271.1| 353|Homo sapiens SNRPB1 protein. 35 0.13 D28877-2|BAA06032.1| 341|Homo sapiens hnRNP A2 protein protein. 35 0.13 D28877-1|BAA06031.1| 353|Homo sapiens hnRNP B1 protein protein. 35 0.13 X79536-1|CAA56072.1| 320|Homo sapiens hnRNPcore protein A1 prot... 33 0.51 X12671-1|CAA31191.1| 320|Homo sapiens hnrnp a1 protein protein. 33 0.51 X06747-1|CAA29922.1| 320|Homo sapiens protein ( Human hnRNP cor... 33 0.51 X04347-1|CAA27874.1| 196|Homo sapiens protein ( Human liver mRN... 33 0.51 BC121133-1|AAI21134.1| 320|Homo sapiens heterogeneous nuclear r... 33 0.51 BC104237-1|AAI04238.1| 167|Homo sapiens HNRPA1 protein protein. 33 0.51 BC104236-1|AAI04237.1| 167|Homo sapiens HNRPA1 protein protein. 33 0.51 BC103707-1|AAI03708.1| 267|Homo sapiens HNRPA1 protein protein. 33 0.51 BC074502-1|AAH74502.1| 320|Homo sapiens heterogeneous nuclear r... 33 0.51 BC073162-1|AAH73162.1| 320|Homo sapiens heterogeneous nuclear r... 33 0.51 BC071945-1|AAH71945.1| 320|Homo sapiens heterogeneous nuclear r... 33 0.51 BC070315-1|AAH70315.1| 320|Homo sapiens HNRPA1 protein protein. 33 0.51 BC052296-1|AAH52296.1| 320|Homo sapiens heterogeneous nuclear r... 33 0.51 BC033714-1|AAH33714.1| 320|Homo sapiens heterogeneous nuclear r... 33 0.51 BC012158-1|AAH12158.1| 320|Homo sapiens heterogeneous nuclear r... 33 0.51 BC009600-1|AAH09600.1| 320|Homo sapiens heterogeneous nuclear r... 33 0.51 BC004945-1|AAH04945.1| 298|Homo sapiens Unknown (protein for IM... 33 0.51 BC002355-1|AAH02355.1| 320|Homo sapiens heterogeneous nuclear r... 33 0.51 AL137058-3|CAI16736.1| 320|Homo sapiens protein ( Human DNA seq... 33 0.51 BC113470-1|AAI13471.1| 378|Homo sapiens LOC653115 protein protein. 32 0.90 BC112027-1|AAI12028.1| 378|Homo sapiens heterogeneous nuclear r... 32 0.90 BC080591-1|AAH80591.1| 189|Homo sapiens HNRPA3 protein protein. 32 0.90 AY363225-1|AAQ63629.1| 378|Homo sapiens heterogeneous nuclear r... 32 0.90 AF517524-1|AAM51824.1| 63|Homo sapiens BX1 protein. 32 0.90 AC079305-1|AAY14709.1| 378|Homo sapiens unknown protein. 32 0.90 BC108266-1|AAI08267.1| 320|Homo sapiens heterogeneous nuclear r... 31 1.6 BC128038-1|AAI28039.1| 146|Homo sapiens LOC728643 protein protein. 30 3.6 BC112995-1|AAI12996.1| 146|Homo sapiens LOC728643 protein protein. 30 3.6 AL354775-1|CAI12730.1| 276|Homo sapiens protein ( Human DNA seq... 30 3.6 >U09123-1|AAB60650.1| 341|Homo sapiens hnRNP protein A2 protein. Length = 341 Score = 34.7 bits (76), Expect = 0.13 Identities = 15/30 (50%), Positives = 19/30 (63%), Gaps = 1/30 (3%) Frame = +1 Query: 49 DFGNYNQQSYGGGPTRNQAYGGN-NRAAPY 135 DFGNYNQQ GP ++ +GG+ N PY Sbjct: 290 DFGNYNQQPSNYGPMKSGNFGGSRNMGGPY 319 >M29065-1|AAA36574.1| 341|Homo sapiens protein ( Human hnRNP A2 protein mRNA. ). Length = 341 Score = 34.7 bits (76), Expect = 0.13 Identities = 15/30 (50%), Positives = 19/30 (63%), Gaps = 1/30 (3%) Frame = +1 Query: 49 DFGNYNQQSYGGGPTRNQAYGGN-NRAAPY 135 DFGNYNQQ GP ++ +GG+ N PY Sbjct: 290 DFGNYNQQPSNYGPMKSGNFGGSRNMGGPY 319 >M29064-1|AAA60271.1| 353|Homo sapiens SNRPB1 protein. Length = 353 Score = 34.7 bits (76), Expect = 0.13 Identities = 15/30 (50%), Positives = 19/30 (63%), Gaps = 1/30 (3%) Frame = +1 Query: 49 DFGNYNQQSYGGGPTRNQAYGGN-NRAAPY 135 DFGNYNQQ GP ++ +GG+ N PY Sbjct: 302 DFGNYNQQPSNYGPMKSGNFGGSRNMGGPY 331 >D28877-2|BAA06032.1| 341|Homo sapiens hnRNP A2 protein protein. Length = 341 Score = 34.7 bits (76), Expect = 0.13 Identities = 15/30 (50%), Positives = 19/30 (63%), Gaps = 1/30 (3%) Frame = +1 Query: 49 DFGNYNQQSYGGGPTRNQAYGGN-NRAAPY 135 DFGNYNQQ GP ++ +GG+ N PY Sbjct: 290 DFGNYNQQPSNYGPMKSGNFGGSRNMGGPY 319 >D28877-1|BAA06031.1| 353|Homo sapiens hnRNP B1 protein protein. Length = 353 Score = 34.7 bits (76), Expect = 0.13 Identities = 15/30 (50%), Positives = 19/30 (63%), Gaps = 1/30 (3%) Frame = +1 Query: 49 DFGNYNQQSYGGGPTRNQAYGGN-NRAAPY 135 DFGNYNQQ GP ++ +GG+ N PY Sbjct: 302 DFGNYNQQPSNYGPMKSGNFGGSRNMGGPY 331 >X79536-1|CAA56072.1| 320|Homo sapiens hnRNPcore protein A1 protein. Length = 320 Score = 32.7 bits (71), Expect = 0.51 Identities = 14/29 (48%), Positives = 18/29 (62%) Frame = +1 Query: 49 DFGNYNQQSYGGGPTRNQAYGGNNRAAPY 135 DFGNYN QS GP + +GG + + PY Sbjct: 262 DFGNYNNQSSNFGPMKGGNFGGRS-SGPY 289 >X12671-1|CAA31191.1| 320|Homo sapiens hnrnp a1 protein protein. Length = 320 Score = 32.7 bits (71), Expect = 0.51 Identities = 14/29 (48%), Positives = 18/29 (62%) Frame = +1 Query: 49 DFGNYNQQSYGGGPTRNQAYGGNNRAAPY 135 DFGNYN QS GP + +GG + + PY Sbjct: 262 DFGNYNNQSSNFGPMKGGNFGGRS-SGPY 289 >X06747-1|CAA29922.1| 320|Homo sapiens protein ( Human hnRNP core protein A1. ). Length = 320 Score = 32.7 bits (71), Expect = 0.51 Identities = 14/29 (48%), Positives = 18/29 (62%) Frame = +1 Query: 49 DFGNYNQQSYGGGPTRNQAYGGNNRAAPY 135 DFGNYN QS GP + +GG + + PY Sbjct: 262 DFGNYNNQSSNFGPMKGGNFGGRS-SGPY 289 >X04347-1|CAA27874.1| 196|Homo sapiens protein ( Human liver mRNA fragment DNA binding protein UPI homologue (C-terminus). ). Length = 196 Score = 32.7 bits (71), Expect = 0.51 Identities = 14/29 (48%), Positives = 18/29 (62%) Frame = +1 Query: 49 DFGNYNQQSYGGGPTRNQAYGGNNRAAPY 135 DFGNYN QS GP + +GG + + PY Sbjct: 138 DFGNYNNQSSNFGPMKGGNFGGRS-SGPY 165 >BC121133-1|AAI21134.1| 320|Homo sapiens heterogeneous nuclear ribonucleoprotein A1 protein. Length = 320 Score = 32.7 bits (71), Expect = 0.51 Identities = 14/29 (48%), Positives = 18/29 (62%) Frame = +1 Query: 49 DFGNYNQQSYGGGPTRNQAYGGNNRAAPY 135 DFGNYN QS GP + +GG + + PY Sbjct: 262 DFGNYNNQSSNFGPMKGGNFGGRS-SGPY 289 >BC104237-1|AAI04238.1| 167|Homo sapiens HNRPA1 protein protein. Length = 167 Score = 32.7 bits (71), Expect = 0.51 Identities = 14/29 (48%), Positives = 18/29 (62%) Frame = +1 Query: 49 DFGNYNQQSYGGGPTRNQAYGGNNRAAPY 135 DFGNYN QS GP + +GG + + PY Sbjct: 109 DFGNYNNQSSNFGPMKGGNFGGRS-SGPY 136 >BC104236-1|AAI04237.1| 167|Homo sapiens HNRPA1 protein protein. Length = 167 Score = 32.7 bits (71), Expect = 0.51 Identities = 14/29 (48%), Positives = 18/29 (62%) Frame = +1 Query: 49 DFGNYNQQSYGGGPTRNQAYGGNNRAAPY 135 DFGNYN QS GP + +GG + + PY Sbjct: 109 DFGNYNNQSSNFGPMKGGNFGGRS-SGPY 136 >BC103707-1|AAI03708.1| 267|Homo sapiens HNRPA1 protein protein. Length = 267 Score = 32.7 bits (71), Expect = 0.51 Identities = 14/29 (48%), Positives = 18/29 (62%) Frame = +1 Query: 49 DFGNYNQQSYGGGPTRNQAYGGNNRAAPY 135 DFGNYN QS GP + +GG + + PY Sbjct: 209 DFGNYNNQSSNFGPMKGGNFGGRS-SGPY 236 >BC074502-1|AAH74502.1| 320|Homo sapiens heterogeneous nuclear ribonucleoprotein A1 protein. Length = 320 Score = 32.7 bits (71), Expect = 0.51 Identities = 14/29 (48%), Positives = 18/29 (62%) Frame = +1 Query: 49 DFGNYNQQSYGGGPTRNQAYGGNNRAAPY 135 DFGNYN QS GP + +GG + + PY Sbjct: 262 DFGNYNNQSSNFGPMKGGNFGGRS-SGPY 289 >BC073162-1|AAH73162.1| 320|Homo sapiens heterogeneous nuclear ribonucleoprotein A1 protein. Length = 320 Score = 32.7 bits (71), Expect = 0.51 Identities = 14/29 (48%), Positives = 18/29 (62%) Frame = +1 Query: 49 DFGNYNQQSYGGGPTRNQAYGGNNRAAPY 135 DFGNYN QS GP + +GG + + PY Sbjct: 262 DFGNYNNQSSNFGPMKGGNFGGRS-SGPY 289 >BC071945-1|AAH71945.1| 320|Homo sapiens heterogeneous nuclear ribonucleoprotein A1 protein. Length = 320 Score = 32.7 bits (71), Expect = 0.51 Identities = 14/29 (48%), Positives = 18/29 (62%) Frame = +1 Query: 49 DFGNYNQQSYGGGPTRNQAYGGNNRAAPY 135 DFGNYN QS GP + +GG + + PY Sbjct: 262 DFGNYNNQSSNFGPMKGGNFGGRS-SGPY 289 >BC070315-1|AAH70315.1| 320|Homo sapiens HNRPA1 protein protein. Length = 320 Score = 32.7 bits (71), Expect = 0.51 Identities = 14/29 (48%), Positives = 18/29 (62%) Frame = +1 Query: 49 DFGNYNQQSYGGGPTRNQAYGGNNRAAPY 135 DFGNYN QS GP + +GG + + PY Sbjct: 262 DFGNYNNQSSNFGPMKGGNFGGRS-SGPY 289 >BC052296-1|AAH52296.1| 320|Homo sapiens heterogeneous nuclear ribonucleoprotein A1 protein. Length = 320 Score = 32.7 bits (71), Expect = 0.51 Identities = 14/29 (48%), Positives = 18/29 (62%) Frame = +1 Query: 49 DFGNYNQQSYGGGPTRNQAYGGNNRAAPY 135 DFGNYN QS GP + +GG + + PY Sbjct: 262 DFGNYNNQSSNFGPMKGGNFGGRS-SGPY 289 >BC033714-1|AAH33714.1| 320|Homo sapiens heterogeneous nuclear ribonucleoprotein A1 protein. Length = 320 Score = 32.7 bits (71), Expect = 0.51 Identities = 14/29 (48%), Positives = 18/29 (62%) Frame = +1 Query: 49 DFGNYNQQSYGGGPTRNQAYGGNNRAAPY 135 DFGNYN QS GP + +GG + + PY Sbjct: 262 DFGNYNNQSSNFGPMKGGNFGGRS-SGPY 289 >BC012158-1|AAH12158.1| 320|Homo sapiens heterogeneous nuclear ribonucleoprotein A1 protein. Length = 320 Score = 32.7 bits (71), Expect = 0.51 Identities = 14/29 (48%), Positives = 18/29 (62%) Frame = +1 Query: 49 DFGNYNQQSYGGGPTRNQAYGGNNRAAPY 135 DFGNYN QS GP + +GG + + PY Sbjct: 262 DFGNYNNQSSNFGPMKGGNFGGRS-SGPY 289 >BC009600-1|AAH09600.1| 320|Homo sapiens heterogeneous nuclear ribonucleoprotein A1 protein. Length = 320 Score = 32.7 bits (71), Expect = 0.51 Identities = 14/29 (48%), Positives = 18/29 (62%) Frame = +1 Query: 49 DFGNYNQQSYGGGPTRNQAYGGNNRAAPY 135 DFGNYN QS GP + +GG + + PY Sbjct: 262 DFGNYNNQSSNFGPMKGGNFGGRS-SGPY 289 >BC004945-1|AAH04945.1| 298|Homo sapiens Unknown (protein for IMAGE:3615335) protein. Length = 298 Score = 32.7 bits (71), Expect = 0.51 Identities = 14/29 (48%), Positives = 18/29 (62%) Frame = +1 Query: 49 DFGNYNQQSYGGGPTRNQAYGGNNRAAPY 135 DFGNYN QS GP + +GG + + PY Sbjct: 240 DFGNYNNQSSNFGPMKGGNFGGRS-SGPY 267 >BC002355-1|AAH02355.1| 320|Homo sapiens heterogeneous nuclear ribonucleoprotein A1 protein. Length = 320 Score = 32.7 bits (71), Expect = 0.51 Identities = 14/29 (48%), Positives = 18/29 (62%) Frame = +1 Query: 49 DFGNYNQQSYGGGPTRNQAYGGNNRAAPY 135 DFGNYN QS GP + +GG + + PY Sbjct: 262 DFGNYNNQSSNFGPMKGGNFGGRS-SGPY 289 >AL137058-3|CAI16736.1| 320|Homo sapiens protein ( Human DNA sequence from clone RP11-78J21 on chromosome 13q32.2-33.3 Contains 2 novel genes, a pseudogene similar to part of TPTE and ). Length = 320 Score = 32.7 bits (71), Expect = 0.51 Identities = 14/29 (48%), Positives = 18/29 (62%) Frame = +1 Query: 49 DFGNYNQQSYGGGPTRNQAYGGNNRAAPY 135 DFGNYN QS GP + +GG + + PY Sbjct: 262 DFGNYNNQSSNFGPMKGGNFGGRS-SGPY 289 >BC113470-1|AAI13471.1| 378|Homo sapiens LOC653115 protein protein. Length = 378 Score = 31.9 bits (69), Expect = 0.90 Identities = 13/30 (43%), Positives = 19/30 (63%), Gaps = 1/30 (3%) Frame = +1 Query: 49 DFGNYN-QQSYGGGPTRNQAYGGNNRAAPY 135 DFGNY+ QQ GP + ++GG + +PY Sbjct: 331 DFGNYSGQQQSNYGPMKGGSFGGRSSGSPY 360 >BC112027-1|AAI12028.1| 378|Homo sapiens heterogeneous nuclear ribonucleoprotein A3 protein. Length = 378 Score = 31.9 bits (69), Expect = 0.90 Identities = 13/30 (43%), Positives = 19/30 (63%), Gaps = 1/30 (3%) Frame = +1 Query: 49 DFGNYN-QQSYGGGPTRNQAYGGNNRAAPY 135 DFGNY+ QQ GP + ++GG + +PY Sbjct: 331 DFGNYSGQQQSNYGPMKGGSFGGRSSGSPY 360 >BC080591-1|AAH80591.1| 189|Homo sapiens HNRPA3 protein protein. Length = 189 Score = 31.9 bits (69), Expect = 0.90 Identities = 13/30 (43%), Positives = 19/30 (63%), Gaps = 1/30 (3%) Frame = +1 Query: 49 DFGNYN-QQSYGGGPTRNQAYGGNNRAAPY 135 DFGNY+ QQ GP + ++GG + +PY Sbjct: 142 DFGNYSGQQQSNYGPMKGGSFGGRSSGSPY 171 >AY363225-1|AAQ63629.1| 378|Homo sapiens heterogeneous nuclear ribonucleoprotein A3 protein. Length = 378 Score = 31.9 bits (69), Expect = 0.90 Identities = 13/30 (43%), Positives = 19/30 (63%), Gaps = 1/30 (3%) Frame = +1 Query: 49 DFGNYN-QQSYGGGPTRNQAYGGNNRAAPY 135 DFGNY+ QQ GP + ++GG + +PY Sbjct: 331 DFGNYSGQQQSNYGPMKGGSFGGRSSGSPY 360 >AF517524-1|AAM51824.1| 63|Homo sapiens BX1 protein. Length = 63 Score = 31.9 bits (69), Expect = 0.90 Identities = 13/30 (43%), Positives = 19/30 (63%), Gaps = 1/30 (3%) Frame = +1 Query: 49 DFGNYN-QQSYGGGPTRNQAYGGNNRAAPY 135 DFGNY+ QQ GP + ++GG + +PY Sbjct: 16 DFGNYSGQQQSNYGPMKGGSFGGRSSGSPY 45 >AC079305-1|AAY14709.1| 378|Homo sapiens unknown protein. Length = 378 Score = 31.9 bits (69), Expect = 0.90 Identities = 13/30 (43%), Positives = 19/30 (63%), Gaps = 1/30 (3%) Frame = +1 Query: 49 DFGNYN-QQSYGGGPTRNQAYGGNNRAAPY 135 DFGNY+ QQ GP + ++GG + +PY Sbjct: 331 DFGNYSGQQQSNYGPMKGGSFGGRSSGSPY 360 >BC108266-1|AAI08267.1| 320|Homo sapiens heterogeneous nuclear ribonucleoprotein A1-like protein. Length = 320 Score = 31.1 bits (67), Expect = 1.6 Identities = 12/24 (50%), Positives = 15/24 (62%) Frame = +1 Query: 49 DFGNYNQQSYGGGPTRNQAYGGNN 120 DFGNYN QS GP + +GG + Sbjct: 262 DFGNYNNQSSNFGPMKGGNFGGRS 285 >BC128038-1|AAI28039.1| 146|Homo sapiens LOC728643 protein protein. Length = 146 Score = 29.9 bits (64), Expect = 3.6 Identities = 11/24 (45%), Positives = 15/24 (62%) Frame = +1 Query: 49 DFGNYNQQSYGGGPTRNQAYGGNN 120 DFGNYN +S GP + +GG + Sbjct: 109 DFGNYNNESSNFGPMKGGNFGGRS 132 >BC112995-1|AAI12996.1| 146|Homo sapiens LOC728643 protein protein. Length = 146 Score = 29.9 bits (64), Expect = 3.6 Identities = 11/24 (45%), Positives = 15/24 (62%) Frame = +1 Query: 49 DFGNYNQQSYGGGPTRNQAYGGNN 120 DFGNYN +S GP + +GG + Sbjct: 109 DFGNYNNESSNFGPMKGGNFGGRS 132 >AL354775-1|CAI12730.1| 276|Homo sapiens protein ( Human DNA sequence from clone RP11-223F20 on chromosome 13 Contains a novel heterogeneous nuclear ribonucleoprotein family A protein and). Length = 276 Score = 29.9 bits (64), Expect = 3.6 Identities = 12/30 (40%), Positives = 19/30 (63%), Gaps = 1/30 (3%) Frame = +1 Query: 49 DFGNYN-QQSYGGGPTRNQAYGGNNRAAPY 135 DFGN++ QQ GP + ++GG + +PY Sbjct: 229 DFGNHSGQQQSNYGPMKGGSFGGRSSGSPY 258 Database: human Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 76,859,062 Number of sequences in database: 237,096 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 50,916,420 Number of Sequences: 237096 Number of extensions: 793380 Number of successful extensions: 1740 Number of sequences better than 10.0: 34 Number of HSP's better than 10.0 without gapping: 1674 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1729 length of database: 76,859,062 effective HSP length: 83 effective length of database: 57,180,094 effective search space used: 3202085264 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -