Samia BLAST Result against arabidopsis

BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= S06A01NCLL0001_N21
         (421 letters)

Database: arabidopsis 
           28,952 sequences; 12,070,560 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

At1g48660.1 68414.m05446 auxin-responsive GH3 family protein sim...    27   3.9  

>At1g48660.1 68414.m05446 auxin-responsive GH3 family protein
           similar to auxin-responsive GH3 product [Glycine max]
           GI:18591; contains Pfam profile PF03321: GH3
           auxin-responsive promoter
          Length = 573

 Score = 27.5 bits (58), Expect = 3.9
 Identities = 12/30 (40%), Positives = 16/30 (53%)
 Frame = -1

Query: 121 CYYHRMLDSLWALHRNSAGCNCQSLGFHPN 32
           CYY  ++ S + LHR   G   Q  GF+ N
Sbjct: 374 CYYETVVTSYFGLHRYLIGDILQVTGFYNN 403


  Database: arabidopsis
    Posted date:  Oct 4, 2007 10:56 AM
  Number of letters in database: 12,070,560
  Number of sequences in database:  28,952
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 7,116,174
Number of Sequences: 28952
Number of extensions: 111905
Number of successful extensions: 313
Number of sequences better than 10.0: 1
Number of HSP's better than 10.0 without gapping: 313
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 313
length of database: 12,070,560
effective HSP length: 74
effective length of database: 9,928,112
effective search space used: 645327280
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)