BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= S06A01NCLL0001_N16 (553 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value DQ157471-1|AAZ85125.1| 1639|Tribolium castaneum Down Syndrome ad... 22 4.1 DQ659250-1|ABG47448.1| 2700|Tribolium castaneum chitinase 10 pro... 21 9.5 >DQ157471-1|AAZ85125.1| 1639|Tribolium castaneum Down Syndrome adhesion molecule splicevariant 3.12.3.1 protein. Length = 1639 Score = 21.8 bits (44), Expect = 4.1 Identities = 10/21 (47%), Positives = 10/21 (47%) Frame = -2 Query: 324 PPRSSFEWTTDNVXLQVYWLP 262 PP S T D L VYW P Sbjct: 998 PPTSIRVETNDQHSLVVYWKP 1018 >DQ659250-1|ABG47448.1| 2700|Tribolium castaneum chitinase 10 protein. Length = 2700 Score = 20.6 bits (41), Expect = 9.5 Identities = 8/30 (26%), Positives = 16/30 (53%) Frame = +3 Query: 285 EHYPSSIQSWSEEVSFQSQEIAKGKSLPYR 374 E YPS + ++ ++E+ ++LP R Sbjct: 35 ERYPSGPELSDRSAAYTNRELYGTRALPLR 64 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 112,460 Number of Sequences: 336 Number of extensions: 2105 Number of successful extensions: 2 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 2 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 2 length of database: 122,585 effective HSP length: 53 effective length of database: 104,777 effective search space used: 13621010 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -