BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= S06A01NCLL0001_N16 (553 letters) Database: spombe 5004 sequences; 2,362,478 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SPAC1687.06c |rpl44|rpl28|60S ribosomal protein L28/L44|Schizosa... 59 5e-10 SPAC31A2.06 |||conserved fungal protein|Schizosaccharomyces pomb... 26 4.2 SPAC6F12.05c |tnr3||thiamine diphosphokinase Tnr3 |Schizosacchar... 25 7.4 SPAC222.10c |byr4||two-component GAP Byr4|Schizosaccharomyces po... 25 7.4 SPCC1902.01 |gaf1|SPCC417.01c|transcription factor Gaf1 |Schizos... 25 9.8 SPBC8D2.05c |sfi1||spindle pole body protein Sfi1|Schizosaccharo... 25 9.8 >SPAC1687.06c |rpl44|rpl28|60S ribosomal protein L28/L44|Schizosaccharomyces pombe|chr 1|||Manual Length = 134 Score = 58.8 bits (136), Expect = 5e-10 Identities = 38/110 (34%), Positives = 56/110 (50%), Gaps = 1/110 (0%) Frame = +3 Query: 54 MSSHLNWMIIRNNNAFLVKKANIKK-PFSKEPNNVTNLNSYRYNGLIHKKAVGVVENPDR 230 +S+ L W +IR+NN FLVK+ F++EP NV+ N+ R++GL + KAVGV N R Sbjct: 3 VSNDLIWQVIRDNNRFLVKRPEFGGIQFNREPVNVSGKNAQRFSGLCNDKAVGVQANSPR 62 Query: 231 KGFTIVYKKAKATNKPVXEHYPSSIQSWSEEVSFQSQEIAKGKSLPYRPD 380 I K KP I + S +++S G++ YR D Sbjct: 63 GVVLITKTNPKNAQKPAKLFRKDVIANASSRKTYKSIAGRIGRT-GYRDD 111 Score = 33.1 bits (72), Expect = 0.028 Identities = 15/22 (68%), Positives = 17/22 (77%) Frame = +1 Query: 364 YRTDLTKATLRRASAILRSQRP 429 YR DL K ++ RASAIL SQRP Sbjct: 108 YRDDLVKVSVARASAILSSQRP 129 >SPAC31A2.06 |||conserved fungal protein|Schizosaccharomyces pombe|chr 1|||Manual Length = 542 Score = 25.8 bits (54), Expect = 4.2 Identities = 12/27 (44%), Positives = 14/27 (51%) Frame = +1 Query: 301 PFKAGARRFLFKAKRLLKANHYRTDLT 381 P GA FL LLK +Y TDL+ Sbjct: 81 PIPKGAPNFLADVLNLLKKKYYATDLS 107 >SPAC6F12.05c |tnr3||thiamine diphosphokinase Tnr3 |Schizosaccharomyces pombe|chr 1|||Manual Length = 569 Score = 25.0 bits (52), Expect = 7.4 Identities = 14/36 (38%), Positives = 21/36 (58%) Frame = -1 Query: 376 GLYGNDLPLAISWL*KETSSLQL*MDDG*CSFTGLL 269 GL+ LP+ S K+TS L+ ++D C F GL+ Sbjct: 507 GLHCGLLPVGQSVYVKKTSGLEWNIEDRICQFGGLV 542 >SPAC222.10c |byr4||two-component GAP Byr4|Schizosaccharomyces pombe|chr 1|||Manual Length = 665 Score = 25.0 bits (52), Expect = 7.4 Identities = 19/83 (22%), Positives = 30/83 (36%) Frame = +3 Query: 81 IRNNNAFLVKKANIKKPFSKEPNNVTNLNSYRYNGLIHKKAVGVVENPDRKGFTIVYKKA 260 IR+ N K I S +PN + Y I ENP + Y Sbjct: 246 IRSPNTINQKHPYISSTISYQPNVHQDAKYYPLCKDIFPSLAN--ENPHSDNPNLKYSSK 303 Query: 261 KATNKPVXEHYPSSIQSWSEEVS 329 + + HYP ++++ S+ S Sbjct: 304 TLSKRDTSSHYPETLKASSKHSS 326 >SPCC1902.01 |gaf1|SPCC417.01c|transcription factor Gaf1 |Schizosaccharomyces pombe|chr 3|||Manual Length = 855 Score = 24.6 bits (51), Expect = 9.8 Identities = 11/27 (40%), Positives = 15/27 (55%) Frame = -2 Query: 324 PPRSSFEWTTDNVXLQVYWLPWPSYKL 244 PP SS E T DN ++ P P+Y + Sbjct: 101 PPTSSAETTADNSDTEMKLNPIPAYSV 127 >SPBC8D2.05c |sfi1||spindle pole body protein Sfi1|Schizosaccharomyces pombe|chr 2|||Manual Length = 840 Score = 24.6 bits (51), Expect = 9.8 Identities = 9/18 (50%), Positives = 12/18 (66%) Frame = +3 Query: 69 NWMIIRNNNAFLVKKANI 122 NWM R N L++KAN+ Sbjct: 289 NWMSKRRRNESLIQKANV 306 Database: spombe Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 2,362,478 Number of sequences in database: 5004 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 1,974,206 Number of Sequences: 5004 Number of extensions: 34677 Number of successful extensions: 94 Number of sequences better than 10.0: 6 Number of HSP's better than 10.0 without gapping: 91 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 93 length of database: 2,362,478 effective HSP length: 69 effective length of database: 2,017,202 effective search space used: 229961028 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -