BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= S06A01NCLL0001_N12 (402 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 04_04_0141 + 23079516-23079925,23080006-23080084,23080204-230803... 149 6e-37 02_04_0360 + 22353057-22353691,22354716-22355144,22355233-223553... 149 6e-37 08_02_0753 - 20805672-20805731,20805825-20805941,20806394-208065... 147 3e-36 11_06_0036 + 19474848-19475188,19475696-19475774,19475880-194760... 144 2e-35 08_02_1026 + 23743186-23743686,23743793-23743915,23744734-237448... 144 2e-35 03_05_0881 + 28461857-28462263,28462357-28462435,28462798-284629... 144 2e-35 01_01_0767 + 5931031-5931281,5931414-5931594,5932020-5932129,593... 91 3e-24 11_06_0360 - 22699524-22699529,22699865-22699899,22700650-227007... 64 4e-11 01_07_0014 - 40455673-40455723,40455815-40455892,40455987-404560... 27 5.6 11_01_0451 + 3499084-3501757,3501907-3502275,3502358-3502389 26 9.7 10_08_0608 + 19184722-19185224,19185331-19185410,19186048-191862... 26 9.7 >04_04_0141 + 23079516-23079925,23080006-23080084,23080204-23080326, 23081655-23081771,23081886-23081945 Length = 262 Score = 149 bits (362), Expect = 6e-37 Identities = 69/96 (71%), Positives = 81/96 (84%) Frame = +2 Query: 113 YLKMKGDYYRYLAEVATGETRHSVVEDSQKAYQDAFEISNAKMQPTHPIRLGLALNFSVF 292 YLKMKGDYYRYLAE TG R E++ AY+ A +I+ A++ PTHPIRLGLALNFSVF Sbjct: 128 YLKMKGDYYRYLAEFKTGAERKDAAENTMVAYKAAQDIALAELPPTHPIRLGLALNFSVF 187 Query: 293 YYEILNSPDKACQLAKQAFDDAIAELDTLNEDSYKD 400 YYEILNSPD+AC LAKQAFD+AI+ELDTL+E+SYKD Sbjct: 188 YYEILNSPDRACNLAKQAFDEAISELDTLSEESYKD 223 Score = 35.5 bits (78), Expect = 0.016 Identities = 15/29 (51%), Positives = 21/29 (72%) Frame = +3 Query: 36 EICYDVLCLLDKHLIPKASNPESKVFTSK 122 +IC +L LL+ HL+P ++ PESKVF K Sbjct: 102 KICDGILKLLESHLVPSSTAPESKVFYLK 130 >02_04_0360 + 22353057-22353691,22354716-22355144,22355233-22355311, 22355472-22355594,22356256-22356372,22356636-22356833 Length = 526 Score = 149 bits (362), Expect = 6e-37 Identities = 69/96 (71%), Positives = 81/96 (84%) Frame = +2 Query: 113 YLKMKGDYYRYLAEVATGETRHSVVEDSQKAYQDAFEISNAKMQPTHPIRLGLALNFSVF 292 YLKMKGDYYRYLAE TG R E++ AY+ A +I+ A++ PTHPIRLGLALNFSVF Sbjct: 346 YLKMKGDYYRYLAEFKTGAERKDAAENTMVAYKAAQDIALAELPPTHPIRLGLALNFSVF 405 Query: 293 YYEILNSPDKACQLAKQAFDDAIAELDTLNEDSYKD 400 YYEILNSPD+AC LAKQAFD+AI+ELDTL+E+SYKD Sbjct: 406 YYEILNSPDRACNLAKQAFDEAISELDTLSEESYKD 441 Score = 37.1 bits (82), Expect = 0.005 Identities = 16/29 (55%), Positives = 21/29 (72%) Frame = +3 Query: 36 EICYDVLCLLDKHLIPKASNPESKVFTSK 122 +IC +L LLD HL+P ++ PESKVF K Sbjct: 320 KICDGILKLLDSHLVPSSTAPESKVFYLK 348 >08_02_0753 - 20805672-20805731,20805825-20805941,20806394-20806516, 20806700-20806778,20806867-20807258 Length = 256 Score = 147 bits (356), Expect = 3e-36 Identities = 69/96 (71%), Positives = 78/96 (81%) Frame = +2 Query: 113 YLKMKGDYYRYLAEVATGETRHSVVEDSQKAYQDAFEISNAKMQPTHPIRLGLALNFSVF 292 YLKMKGDY+RYLAE TG R E + AY+ A +I+ A + PTHPIRLGLALNFSVF Sbjct: 122 YLKMKGDYHRYLAEFKTGAERKEAAESTMVAYKAAQDIALADLAPTHPIRLGLALNFSVF 181 Query: 293 YYEILNSPDKACQLAKQAFDDAIAELDTLNEDSYKD 400 YYEILNSPDKAC LAKQAFD+AI+ELDTL E+SYKD Sbjct: 182 YYEILNSPDKACNLAKQAFDEAISELDTLGEESYKD 217 Score = 33.9 bits (74), Expect = 0.048 Identities = 15/29 (51%), Positives = 20/29 (68%) Frame = +3 Query: 36 EICYDVLCLLDKHLIPKASNPESKVFTSK 122 +IC +L LLD HL+P ++ ESKVF K Sbjct: 96 KICDGILKLLDSHLVPSSTAAESKVFYLK 124 >11_06_0036 + 19474848-19475188,19475696-19475774,19475880-19476002, 19476970-19477086,19477169-19477228 Length = 239 Score = 144 bits (350), Expect = 2e-35 Identities = 66/96 (68%), Positives = 79/96 (82%) Frame = +2 Query: 113 YLKMKGDYYRYLAEVATGETRHSVVEDSQKAYQDAFEISNAKMQPTHPIRLGLALNFSVF 292 YLKMKGDY+RYLAE +G+ R E + AY+ A +I+ A + PTHPIRLGLALNFSVF Sbjct: 105 YLKMKGDYHRYLAEFKSGDERKQAAESTMNAYKAAQDIALADLAPTHPIRLGLALNFSVF 164 Query: 293 YYEILNSPDKACQLAKQAFDDAIAELDTLNEDSYKD 400 YYEILNSPD+AC LAKQAFD+AI+ELD+L E+SYKD Sbjct: 165 YYEILNSPDRACNLAKQAFDEAISELDSLGEESYKD 200 Score = 35.5 bits (78), Expect = 0.016 Identities = 16/28 (57%), Positives = 18/28 (64%) Frame = +3 Query: 39 ICYDVLCLLDKHLIPKASNPESKVFTSK 122 IC +L LLD HL+P A ESKVF K Sbjct: 80 ICDGILALLDSHLVPSAGAAESKVFYLK 107 >08_02_1026 + 23743186-23743686,23743793-23743915,23744734-23744850, 23744948-23745001 Length = 264 Score = 144 bits (349), Expect = 2e-35 Identities = 67/96 (69%), Positives = 78/96 (81%) Frame = +2 Query: 113 YLKMKGDYYRYLAEVATGETRHSVVEDSQKAYQDAFEISNAKMQPTHPIRLGLALNFSVF 292 YLKMKGDY+RYLAE TG R + + AYQ A +I+ ++ PTHPIRLGLALNFSVF Sbjct: 132 YLKMKGDYHRYLAEFKTGAERKDAADATLAAYQAAQDIAMKELSPTHPIRLGLALNFSVF 191 Query: 293 YYEILNSPDKACQLAKQAFDDAIAELDTLNEDSYKD 400 YYEILNSPD+AC LAKQAFD+AI+ELDTL E+SYKD Sbjct: 192 YYEILNSPDRACTLAKQAFDEAISELDTLGEESYKD 227 Score = 29.1 bits (62), Expect = 1.4 Identities = 13/28 (46%), Positives = 19/28 (67%) Frame = +3 Query: 39 ICYDVLCLLDKHLIPKASNPESKVFTSK 122 IC +L LLD+ L+P A+ ++KVF K Sbjct: 107 ICAGILRLLDERLVPAAAAVDAKVFYLK 134 >03_05_0881 + 28461857-28462263,28462357-28462435,28462798-28462920, 28463632-28463748,28463861-28463917 Length = 260 Score = 144 bits (349), Expect = 2e-35 Identities = 68/96 (70%), Positives = 78/96 (81%) Frame = +2 Query: 113 YLKMKGDYYRYLAEVATGETRHSVVEDSQKAYQDAFEISNAKMQPTHPIRLGLALNFSVF 292 YLKMKGDY+RYLAE +G R E++ AY+ A +I+ A + THPIRLGLALNFSVF Sbjct: 127 YLKMKGDYHRYLAEFKSGAERKEAAENTLVAYKSAQDIALADLPTTHPIRLGLALNFSVF 186 Query: 293 YYEILNSPDKACQLAKQAFDDAIAELDTLNEDSYKD 400 YYEILNSPD+AC LAKQAFDDAIAELDTL E+SYKD Sbjct: 187 YYEILNSPDRACNLAKQAFDDAIAELDTLGEESYKD 222 Score = 35.1 bits (77), Expect = 0.021 Identities = 16/29 (55%), Positives = 20/29 (68%) Frame = +3 Query: 36 EICYDVLCLLDKHLIPKASNPESKVFTSK 122 +IC +L LLD HL+P A+ ESKVF K Sbjct: 101 KICDGILKLLDSHLVPSATAAESKVFYLK 129 >01_01_0767 + 5931031-5931281,5931414-5931594,5932020-5932129, 5932212-5932360,5932686-5932738,5933168-5933260 Length = 278 Score = 91.1 bits (216), Expect(2) = 3e-24 Identities = 41/62 (66%), Positives = 51/62 (82%) Frame = +2 Query: 215 AFEISNAKMQPTHPIRLGLALNFSVFYYEILNSPDKACQLAKQAFDDAIAELDTLNEDSY 394 A + + + PT PIRLGLALN SVFY EI+NSPDKACQLAK AFD+A+AEL +L+E++Y Sbjct: 146 ASKTAQTDLTPTDPIRLGLALNISVFYCEIMNSPDKACQLAKNAFDEAVAELPSLSEENY 205 Query: 395 KD 400 KD Sbjct: 206 KD 207 Score = 37.5 bits (83), Expect(2) = 3e-24 Identities = 21/38 (55%), Positives = 23/38 (60%), Gaps = 2/38 (5%) Frame = +2 Query: 125 KGDYYRYLAEVATGETRHSVVEDSQKAYQ--DAFEISN 232 KGDYYRYLAE TG + V E S AY+ D F I N Sbjct: 85 KGDYYRYLAEFKTGTEKIEVSELSLNAYEACDPFFIFN 122 >11_06_0360 - 22699524-22699529,22699865-22699899,22700650-22700792, 22701165-22701220,22701367-22701454,22702737-22703037, 22704365-22704428 Length = 230 Score = 64.1 bits (149), Expect = 4e-11 Identities = 40/96 (41%), Positives = 55/96 (57%) Frame = +2 Query: 113 YLKMKGDYYRYLAEVATGETRHSVVEDSQKAYQDAFEISNAKMQPTHPIRLGLALNFSVF 292 + KMKGDYYRYLAE +TG + + + S AYQ P A FS+ Sbjct: 119 FYKMKGDYYRYLAEFSTGTEKKAATDQSLMAYQ------------AWPC----AQLFSLL 162 Query: 293 YYEILNSPDKACQLAKQAFDDAIAELDTLNEDSYKD 400 EI+NSP++A Q+AKQA D+A AE+++ + YKD Sbjct: 163 --EIMNSPERASQVAKQALDEATAEINSAGVEGYKD 196 >01_07_0014 - 40455673-40455723,40455815-40455892,40455987-40456049, 40456250-40456390,40456851-40456949,40457403-40457477, 40457556-40457652,40457738-40457805,40458456-40458512, 40458613-40458671,40458798-40458921,40459208-40459264, 40459378-40459457,40459585-40459793,40459868-40459986 Length = 458 Score = 27.1 bits (57), Expect = 5.6 Identities = 14/34 (41%), Positives = 18/34 (52%) Frame = +2 Query: 299 EILNSPDKACQLAKQAFDDAIAELDTLNEDSYKD 400 E+ + A LAK A DD EL LN D+Y + Sbjct: 73 EVAQAKAAAKALAKGAVDDVADELKELNMDNYDE 106 >11_01_0451 + 3499084-3501757,3501907-3502275,3502358-3502389 Length = 1024 Score = 26.2 bits (55), Expect = 9.7 Identities = 11/29 (37%), Positives = 16/29 (55%) Frame = -3 Query: 190 LYNRMSGFSCGHFCEIPVVISLHFEVNTL 104 LYN + G F ++PV++ LH N L Sbjct: 199 LYNNIDGNIPDDFAKLPVLVYLHLGANKL 227 >10_08_0608 + 19184722-19185224,19185331-19185410,19186048-19186235, 19187021-19187927,19188015-19188142,19189270-19189356, 19189422-19189472,19189582-19189668,19189746-19189873, 19190469-19190608,19190721-19190882,19190964-19192733, 19192807-19192922,19193077-19193227,19193243-19193371, 19193598-19194139 Length = 1722 Score = 26.2 bits (55), Expect = 9.7 Identities = 10/23 (43%), Positives = 16/23 (69%) Frame = -3 Query: 169 FSCGHFCEIPVVISLHFEVNTLL 101 F+ H CEI + + +HF ++TLL Sbjct: 694 FNSYHHCEIIICMRIHFFMHTLL 716 Database: rice Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 11,774,116 Number of Sequences: 37544 Number of extensions: 241488 Number of successful extensions: 675 Number of sequences better than 10.0: 11 Number of HSP's better than 10.0 without gapping: 659 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 675 length of database: 14,793,348 effective HSP length: 75 effective length of database: 11,977,548 effective search space used: 694697784 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -