BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= S06A01NCLL0001_N11 (445 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value EF592538-1|ABQ95984.1| 582|Tribolium castaneum beta-N-acetylglu... 22 2.3 AY295880-2|AAQ62694.1| 1558|Tribolium castaneum chitin synthase ... 20 9.2 AY295880-1|AAQ62693.1| 1558|Tribolium castaneum chitin synthase ... 20 9.2 AY291476-1|AAQ55060.1| 1558|Tribolium castaneum chitin synthase ... 20 9.2 AY291475-1|AAQ55059.1| 1558|Tribolium castaneum chitin synthase ... 20 9.2 >EF592538-1|ABQ95984.1| 582|Tribolium castaneum beta-N-acetylglucosaminidase NAG3 protein. Length = 582 Score = 22.2 bits (45), Expect = 2.3 Identities = 10/31 (32%), Positives = 14/31 (45%) Frame = -3 Query: 410 YSWLASTFSVCKPLMEATGTYVTRVNSLCAE 318 Y+W K L+E T + N LC+E Sbjct: 44 YTWKCENQKCVKYLVEDEETSLATCNMLCSE 74 >AY295880-2|AAQ62694.1| 1558|Tribolium castaneum chitin synthase variant 2 protein. Length = 1558 Score = 20.2 bits (40), Expect = 9.2 Identities = 6/17 (35%), Positives = 12/17 (70%) Frame = -2 Query: 213 YVWSTHLFFSESPDLLD 163 Y + TH+FF ++ ++ D Sbjct: 609 YEFETHIFFDDAFEISD 625 >AY295880-1|AAQ62693.1| 1558|Tribolium castaneum chitin synthase variant 1 protein. Length = 1558 Score = 20.2 bits (40), Expect = 9.2 Identities = 6/17 (35%), Positives = 12/17 (70%) Frame = -2 Query: 213 YVWSTHLFFSESPDLLD 163 Y + TH+FF ++ ++ D Sbjct: 609 YEFETHIFFDDAFEISD 625 >AY291476-1|AAQ55060.1| 1558|Tribolium castaneum chitin synthase CHS1B protein. Length = 1558 Score = 20.2 bits (40), Expect = 9.2 Identities = 6/17 (35%), Positives = 12/17 (70%) Frame = -2 Query: 213 YVWSTHLFFSESPDLLD 163 Y + TH+FF ++ ++ D Sbjct: 609 YEFETHIFFDDAFEISD 625 >AY291475-1|AAQ55059.1| 1558|Tribolium castaneum chitin synthase CHS1A protein. Length = 1558 Score = 20.2 bits (40), Expect = 9.2 Identities = 6/17 (35%), Positives = 12/17 (70%) Frame = -2 Query: 213 YVWSTHLFFSESPDLLD 163 Y + TH+FF ++ ++ D Sbjct: 609 YEFETHIFFDDAFEISD 625 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 112,979 Number of Sequences: 336 Number of extensions: 2473 Number of successful extensions: 5 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 5 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 5 length of database: 122,585 effective HSP length: 52 effective length of database: 105,113 effective search space used: 9985735 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 40 (21.2 bits)
- SilkBase 1999-2023 -