BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= S06A01NCLL0001_N10 (541 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 03_05_0824 + 27980191-27980243,27980633-27980671,27980974-279820... 29 3.1 03_06_0456 + 34057986-34058186,34058295-34058978,34059063-34059434 28 4.1 >03_05_0824 + 27980191-27980243,27980633-27980671,27980974-27982023, 27983097-27983262,27983439-27983549,27983637-27983688, 27984691-27984859,27985604-27985883 Length = 639 Score = 28.7 bits (61), Expect = 3.1 Identities = 15/35 (42%), Positives = 20/35 (57%) Frame = -3 Query: 449 LYLHLIPVIHDYNVSKMKH*KFGSLLTLPLQIHAI 345 LYL +I ++ +YNVSK SL PL I A+ Sbjct: 584 LYLGIIDILQEYNVSKRVEHAVKSLKFDPLSISAV 618 >03_06_0456 + 34057986-34058186,34058295-34058978,34059063-34059434 Length = 418 Score = 28.3 bits (60), Expect = 4.1 Identities = 10/23 (43%), Positives = 15/23 (65%) Frame = -3 Query: 365 PLQIHAILFIHLKYLLFSICGYL 297 P+ +HAI + Y+ F +CGYL Sbjct: 249 PVLLHAIAGVTAVYVCFGVCGYL 271 Database: rice Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 10,564,502 Number of Sequences: 37544 Number of extensions: 167345 Number of successful extensions: 292 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 286 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 292 length of database: 14,793,348 effective HSP length: 78 effective length of database: 11,864,916 effective search space used: 1198356516 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -