Samia BLAST Result against mosquito

BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= S06A01NCLL0001_N10
         (541 letters)

Database: mosquito 
           2352 sequences; 563,979 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

AY705394-1|AAU12503.1|  557|Anopheles gambiae nicotinic acetylch...    24   3.7  
DQ219482-1|ABB29886.1|  545|Anopheles gambiae cryptochrome 1 pro...    23   8.7  

>AY705394-1|AAU12503.1|  557|Anopheles gambiae nicotinic
           acetylcholine receptor subunitalpha 1 protein.
          Length = 557

 Score = 23.8 bits (49), Expect = 3.7
 Identities = 11/36 (30%), Positives = 16/36 (44%)
 Frame = +1

Query: 370 VRREPNFQCFILDTL*SWITGIKCKYKLCLSFFVSP 477
           V+ +  +   +LD L  WI  I C    CL    +P
Sbjct: 491 VKEDWKYVALVLDRLFLWIFTIACVLGTCLIILQAP 526


>DQ219482-1|ABB29886.1|  545|Anopheles gambiae cryptochrome 1
           protein.
          Length = 545

 Score = 22.6 bits (46), Expect = 8.7
 Identities = 6/12 (50%), Positives = 9/12 (75%)
 Frame = -1

Query: 190 WRTYFYSLPINN 155
           WR YFY++ + N
Sbjct: 311 WREYFYTMSVQN 322


  Database: mosquito
    Posted date:  Oct 23, 2007  1:18 PM
  Number of letters in database: 563,979
  Number of sequences in database:  2352
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 453,971
Number of Sequences: 2352
Number of extensions: 7012
Number of successful extensions: 10
Number of sequences better than 10.0: 2
Number of HSP's better than 10.0 without gapping: 10
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 10
length of database: 563,979
effective HSP length: 60
effective length of database: 422,859
effective search space used: 50320221
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)