BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= S06A01NCLL0001_N10 (541 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AY705394-1|AAU12503.1| 557|Anopheles gambiae nicotinic acetylch... 24 3.7 DQ219482-1|ABB29886.1| 545|Anopheles gambiae cryptochrome 1 pro... 23 8.7 >AY705394-1|AAU12503.1| 557|Anopheles gambiae nicotinic acetylcholine receptor subunitalpha 1 protein. Length = 557 Score = 23.8 bits (49), Expect = 3.7 Identities = 11/36 (30%), Positives = 16/36 (44%) Frame = +1 Query: 370 VRREPNFQCFILDTL*SWITGIKCKYKLCLSFFVSP 477 V+ + + +LD L WI I C CL +P Sbjct: 491 VKEDWKYVALVLDRLFLWIFTIACVLGTCLIILQAP 526 >DQ219482-1|ABB29886.1| 545|Anopheles gambiae cryptochrome 1 protein. Length = 545 Score = 22.6 bits (46), Expect = 8.7 Identities = 6/12 (50%), Positives = 9/12 (75%) Frame = -1 Query: 190 WRTYFYSLPINN 155 WR YFY++ + N Sbjct: 311 WREYFYTMSVQN 322 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 453,971 Number of Sequences: 2352 Number of extensions: 7012 Number of successful extensions: 10 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 10 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 10 length of database: 563,979 effective HSP length: 60 effective length of database: 422,859 effective search space used: 50320221 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -