BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= S06A01NCLL0001_N09 (480 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value AY600516-1|AAT11864.1| 143|Tribolium castaneum optomotor-blind-... 22 2.6 AY600515-1|AAT11863.1| 134|Tribolium castaneum optomotor-blind-... 22 2.6 DQ157471-1|AAZ85125.1| 1639|Tribolium castaneum Down Syndrome ad... 21 4.5 AM292381-1|CAL23193.2| 364|Tribolium castaneum gustatory recept... 21 5.9 >AY600516-1|AAT11864.1| 143|Tribolium castaneum optomotor-blind-like protein protein. Length = 143 Score = 22.2 bits (45), Expect = 2.6 Identities = 10/26 (38%), Positives = 17/26 (65%) Frame = +1 Query: 34 MKLNVSYPATGCQKLFEVVDEHKLRI 111 M ++ P+TG Q + +VV HKL++ Sbjct: 54 MYIHPDSPSTGEQWMQKVVSFHKLKL 79 >AY600515-1|AAT11863.1| 134|Tribolium castaneum optomotor-blind-like protein protein. Length = 134 Score = 22.2 bits (45), Expect = 2.6 Identities = 10/26 (38%), Positives = 17/26 (65%) Frame = +1 Query: 34 MKLNVSYPATGCQKLFEVVDEHKLRI 111 M ++ P+TG Q + +VV HKL++ Sbjct: 54 MYIHPDSPSTGEQWMQKVVSFHKLKL 79 >DQ157471-1|AAZ85125.1| 1639|Tribolium castaneum Down Syndrome adhesion molecule splicevariant 3.12.3.1 protein. Length = 1639 Score = 21.4 bits (43), Expect = 4.5 Identities = 11/34 (32%), Positives = 19/34 (55%) Frame = +1 Query: 82 EVVDEHKLRIFYEKRMGAEVDADLLGDEWKGYVL 183 E D+H L ++++ E + D+LG + GY L Sbjct: 1005 ETNDQHSLVVYWKPPAREEWNGDILG-YYVGYRL 1037 >AM292381-1|CAL23193.2| 364|Tribolium castaneum gustatory receptor candidate 60 protein. Length = 364 Score = 21.0 bits (42), Expect = 5.9 Identities = 8/15 (53%), Positives = 12/15 (80%) Frame = +2 Query: 311 NASLFVVALLMLTFQ 355 NASLF+ L+ L+F+ Sbjct: 142 NASLFIFDLIFLSFR 156 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 106,141 Number of Sequences: 336 Number of extensions: 2194 Number of successful extensions: 9 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 9 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 9 length of database: 122,585 effective HSP length: 52 effective length of database: 105,113 effective search space used: 11247091 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 40 (21.2 bits)
- SilkBase 1999-2023 -