BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= S06A01NCLL0001_N07 (508 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_25368| Best HMM Match : PID (HMM E-Value=2.7e-22) 29 2.2 SB_37907| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 6.7 SB_21189| Best HMM Match : PCI (HMM E-Value=8.2) 27 6.7 SB_2744| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 8.9 >SB_25368| Best HMM Match : PID (HMM E-Value=2.7e-22) Length = 1197 Score = 29.1 bits (62), Expect = 2.2 Identities = 17/52 (32%), Positives = 26/52 (50%) Frame = -1 Query: 481 TRPSTV*TKSMQESDGSSNVALSASDSLVLFLSPSIRTDDSSNPTTCARFPP 326 T P + KS+ + S V LS DSL + +P+ +TD +P+ PP Sbjct: 811 TEPIYINRKSLSSPEPESAVELSRPDSLTM-EAPTTKTDRPLSPSAPPPLPP 861 >SB_37907| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 93 Score = 27.5 bits (58), Expect = 6.7 Identities = 15/54 (27%), Positives = 24/54 (44%) Frame = -3 Query: 227 ELIDARLRHCQENVFNSTGAEWKIQKRLFTQNNIGQTKFYFECIHKVDNVLFIF 66 E ++ +R CQ N A W +RL +Q +I K I +++ L F Sbjct: 9 ETTESAVRRCQRNSVMDIDAAWPKFQRLKSQFSINSKKISMNDIKRLEAALIPF 62 >SB_21189| Best HMM Match : PCI (HMM E-Value=8.2) Length = 125 Score = 27.5 bits (58), Expect = 6.7 Identities = 15/54 (27%), Positives = 24/54 (44%) Frame = -3 Query: 227 ELIDARLRHCQENVFNSTGAEWKIQKRLFTQNNIGQTKFYFECIHKVDNVLFIF 66 E ++ +R CQ N A W +RL +Q +I K I +++ L F Sbjct: 41 ETTESAVRRCQRNSVMDIDAAWPKFQRLKSQFSINSKKISMNDIKRLEAALIPF 94 >SB_2744| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 205 Score = 27.1 bits (57), Expect = 8.9 Identities = 12/33 (36%), Positives = 20/33 (60%) Frame = -1 Query: 127 LDKPSFILSVSIKSITFFSYLSNVSHPVLTKGI 29 LDK + L+V++ ++ Y NV+ P L KG+ Sbjct: 88 LDKGKYALNVTVPTLDKGKYALNVTVPTLDKGM 120 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 14,824,189 Number of Sequences: 59808 Number of extensions: 274877 Number of successful extensions: 694 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 640 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 693 length of database: 16,821,457 effective HSP length: 77 effective length of database: 12,216,241 effective search space used: 1111677931 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -