BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= S06A01NCLL0001_N07 (508 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AF487534-1|AAL93295.1| 509|Anopheles gambiae cytochrome P450 CY... 25 1.9 AJ438610-4|CAD27476.1| 593|Anopheles gambiae putative transcrip... 24 2.6 AF281078-1|AAF82131.1| 2051|Anopheles gambiae vitellogenin 1 pro... 24 2.6 AY344825-1|AAR02436.1| 153|Anopheles gambiae peritrophin A prot... 24 3.4 AY578806-1|AAT07311.1| 110|Anopheles gambiae myoglianin protein. 23 4.5 AY344828-1|AAR02439.1| 153|Anopheles gambiae peritrophin A prot... 23 5.9 AY344827-1|AAR02438.1| 153|Anopheles gambiae peritrophin A prot... 23 5.9 AY344826-1|AAR02437.1| 153|Anopheles gambiae peritrophin A prot... 23 5.9 AY344824-1|AAR02435.1| 153|Anopheles gambiae peritrophin A prot... 23 5.9 AF030431-1|AAC39127.1| 153|Anopheles gambiae peritrophin 1 prot... 23 5.9 DQ974163-1|ABJ52803.1| 595|Anopheles gambiae serpin 4B protein. 23 7.9 CR954257-2|CAJ14153.1| 1664|Anopheles gambiae Tubby protein. 23 7.9 AY578804-1|AAT07309.1| 133|Anopheles gambiae maverick protein. 23 7.9 >AF487534-1|AAL93295.1| 509|Anopheles gambiae cytochrome P450 CYP6P3 protein. Length = 509 Score = 24.6 bits (51), Expect = 1.9 Identities = 13/41 (31%), Positives = 16/41 (39%) Frame = -3 Query: 221 IDARLRHCQENVFNSTGAEWKIQKRLFTQNNIGQTKFYFEC 99 + L C E +N E K FT + IG F EC Sbjct: 156 VGLELEKCMEQSYNQPEVEMKDILGRFTTDVIGTCAFGIEC 196 >AJ438610-4|CAD27476.1| 593|Anopheles gambiae putative transcription factor protein. Length = 593 Score = 24.2 bits (50), Expect = 2.6 Identities = 10/21 (47%), Positives = 12/21 (57%) Frame = -1 Query: 388 LSPSIRTDDSSNPTTCARFPP 326 LSP R SSN ++C R P Sbjct: 255 LSPDFRQRASSNASSCGRLSP 275 >AF281078-1|AAF82131.1| 2051|Anopheles gambiae vitellogenin 1 protein. Length = 2051 Score = 24.2 bits (50), Expect = 2.6 Identities = 11/25 (44%), Positives = 14/25 (56%) Frame = -3 Query: 263 FEYNTANKFE*DELIDARLRHCQEN 189 +EYN N F DE I RH ++N Sbjct: 1708 YEYNWKNGFGEDEQITILARHGEDN 1732 >AY344825-1|AAR02436.1| 153|Anopheles gambiae peritrophin A protein. Length = 153 Score = 23.8 bits (49), Expect = 3.4 Identities = 12/33 (36%), Positives = 17/33 (51%) Frame = -1 Query: 418 LSASDSLVLFLSPSIRTDDSSNPTTCARFPPHL 320 + S SLVL L+ ++ DD P + PP L Sbjct: 1 MKVSASLVLLLAAAVLADDRCPPQDDPKQPPVL 33 >AY578806-1|AAT07311.1| 110|Anopheles gambiae myoglianin protein. Length = 110 Score = 23.4 bits (48), Expect = 4.5 Identities = 7/17 (41%), Positives = 12/17 (70%) Frame = -1 Query: 379 SIRTDDSSNPTTCARFP 329 S+ D+++N T C R+P Sbjct: 7 SLNCDENANETRCCRYP 23 >AY344828-1|AAR02439.1| 153|Anopheles gambiae peritrophin A protein. Length = 153 Score = 23.0 bits (47), Expect = 5.9 Identities = 12/33 (36%), Positives = 16/33 (48%) Frame = -1 Query: 418 LSASDSLVLFLSPSIRTDDSSNPTTCARFPPHL 320 + S SLVL L+ ++ DD P PP L Sbjct: 1 MKVSASLVLLLAAAVLADDRCPPQDDPEQPPVL 33 >AY344827-1|AAR02438.1| 153|Anopheles gambiae peritrophin A protein. Length = 153 Score = 23.0 bits (47), Expect = 5.9 Identities = 12/33 (36%), Positives = 16/33 (48%) Frame = -1 Query: 418 LSASDSLVLFLSPSIRTDDSSNPTTCARFPPHL 320 + S SLVL L+ ++ DD P PP L Sbjct: 1 MKVSASLVLLLAAAVLADDRCPPQDDPEQPPVL 33 >AY344826-1|AAR02437.1| 153|Anopheles gambiae peritrophin A protein. Length = 153 Score = 23.0 bits (47), Expect = 5.9 Identities = 12/33 (36%), Positives = 16/33 (48%) Frame = -1 Query: 418 LSASDSLVLFLSPSIRTDDSSNPTTCARFPPHL 320 + S SLVL L+ ++ DD P PP L Sbjct: 1 MKVSASLVLLLAAAVLADDRCPPQDDPEQPPVL 33 >AY344824-1|AAR02435.1| 153|Anopheles gambiae peritrophin A protein. Length = 153 Score = 23.0 bits (47), Expect = 5.9 Identities = 12/33 (36%), Positives = 16/33 (48%) Frame = -1 Query: 418 LSASDSLVLFLSPSIRTDDSSNPTTCARFPPHL 320 + S SLVL L+ ++ DD P PP L Sbjct: 1 MKVSASLVLLLAAAVLADDRCPPQDDPEQPPVL 33 >AF030431-1|AAC39127.1| 153|Anopheles gambiae peritrophin 1 protein. Length = 153 Score = 23.0 bits (47), Expect = 5.9 Identities = 12/33 (36%), Positives = 16/33 (48%) Frame = -1 Query: 418 LSASDSLVLFLSPSIRTDDSSNPTTCARFPPHL 320 + S SLVL L+ ++ DD P PP L Sbjct: 1 MKVSASLVLLLAAAVLADDRCPPQDDPEQPPVL 33 >DQ974163-1|ABJ52803.1| 595|Anopheles gambiae serpin 4B protein. Length = 595 Score = 22.6 bits (46), Expect = 7.9 Identities = 9/28 (32%), Positives = 17/28 (60%) Frame = +1 Query: 22 TSVCLLSKLDVIHSTNMKRTLSTLWIHS 105 TS+ L K+ + ++ ++KR L L + S Sbjct: 337 TSIILFPKMHISNTMDLKRVLQQLGVSS 364 >CR954257-2|CAJ14153.1| 1664|Anopheles gambiae Tubby protein. Length = 1664 Score = 22.6 bits (46), Expect = 7.9 Identities = 13/35 (37%), Positives = 18/35 (51%) Frame = -1 Query: 436 GSSNVALSASDSLVLFLSPSIRTDDSSNPTTCARF 332 GS + A A + SPS TDDSS T+ ++ Sbjct: 1513 GSGSGAGGAGSAGPNHSSPSNHTDDSSGSTSAKQY 1547 >AY578804-1|AAT07309.1| 133|Anopheles gambiae maverick protein. Length = 133 Score = 22.6 bits (46), Expect = 7.9 Identities = 8/18 (44%), Positives = 11/18 (61%) Frame = +2 Query: 164 IPRRCC*TRSLDSV*ALH 217 +P+ CC SLD + LH Sbjct: 91 VPKPCCAPSSLDHIDVLH 108 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 495,687 Number of Sequences: 2352 Number of extensions: 9094 Number of successful extensions: 23 Number of sequences better than 10.0: 13 Number of HSP's better than 10.0 without gapping: 23 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 23 length of database: 563,979 effective HSP length: 60 effective length of database: 422,859 effective search space used: 45668772 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -