BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= S06A01NCLL0001_N06 (464 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AF364131-1|AAL35507.1| 378|Anopheles gambiae putative odorant r... 25 1.3 AY146716-1|AAO12076.1| 159|Anopheles gambiae odorant-binding pr... 23 5.3 >AF364131-1|AAL35507.1| 378|Anopheles gambiae putative odorant receptor Or2 protein. Length = 378 Score = 25.0 bits (52), Expect = 1.3 Identities = 12/31 (38%), Positives = 18/31 (58%) Frame = -2 Query: 205 LTSSWLDKSALMINGFLPLAVHSPATFSSFV 113 L SSW D S L+ING+ + + +SF+ Sbjct: 48 LYSSWGDMSELIINGYFTVLYFNLVLRTSFL 78 >AY146716-1|AAO12076.1| 159|Anopheles gambiae odorant-binding protein AgamOBP12 protein. Length = 159 Score = 23.0 bits (47), Expect = 5.3 Identities = 9/26 (34%), Positives = 13/26 (50%) Frame = -2 Query: 316 YASRRFPSSRLPCFIIPALFTRISIF 239 Y R FP +L C + L R+ I+ Sbjct: 59 YKKRIFPDDQLTCCVFRCLGMRLGIY 84 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 421,224 Number of Sequences: 2352 Number of extensions: 7654 Number of successful extensions: 9 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 9 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 9 length of database: 563,979 effective HSP length: 59 effective length of database: 425,211 effective search space used: 40395045 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -