BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= S06A01NCLL0001_N02 (405 letters) Database: celegans 27,780 sequences; 12,740,198 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Z49207-8|CAJ85773.1| 455|Caenorhabditis elegans Hypothetical pr... 27 3.9 Z49207-7|CAA89072.1| 512|Caenorhabditis elegans Hypothetical pr... 27 3.9 >Z49207-8|CAJ85773.1| 455|Caenorhabditis elegans Hypothetical protein R07E3.5b protein. Length = 455 Score = 27.5 bits (58), Expect = 3.9 Identities = 18/52 (34%), Positives = 29/52 (55%) Frame = -2 Query: 164 HYFNFIEY*LCVRGFTRVYYILNCVITAFLKIFGICLMVLCPLNRSLSTLVP 9 H+FN+ L + GF YY+L + + +FGI + VL ++ S+ LVP Sbjct: 93 HFFNWQLTLLWIAGFMFRYYVL---VPCRIALFGIAI-VLMIVSTSIIGLVP 140 >Z49207-7|CAA89072.1| 512|Caenorhabditis elegans Hypothetical protein R07E3.5a protein. Length = 512 Score = 27.5 bits (58), Expect = 3.9 Identities = 18/52 (34%), Positives = 29/52 (55%) Frame = -2 Query: 164 HYFNFIEY*LCVRGFTRVYYILNCVITAFLKIFGICLMVLCPLNRSLSTLVP 9 H+FN+ L + GF YY+L + + +FGI + VL ++ S+ LVP Sbjct: 150 HFFNWQLTLLWIAGFMFRYYVL---VPCRIALFGIAI-VLMIVSTSIIGLVP 197 Database: celegans Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 12,740,198 Number of sequences in database: 27,780 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 8,355,737 Number of Sequences: 27780 Number of extensions: 145458 Number of successful extensions: 266 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 264 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 266 length of database: 12,740,198 effective HSP length: 74 effective length of database: 10,684,478 effective search space used: 641068680 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -