BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= S06A01NCLL0001_M22 (423 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AB090818-2|BAC57912.1| 988|Anopheles gambiae reverse transcript... 25 1.5 AB090814-1|BAC57903.1| 499|Anopheles gambiae gag-like protein p... 24 2.6 >AB090818-2|BAC57912.1| 988|Anopheles gambiae reverse transcriptase protein. Length = 988 Score = 24.6 bits (51), Expect = 1.5 Identities = 14/44 (31%), Positives = 25/44 (56%), Gaps = 1/44 (2%) Frame = -3 Query: 157 FVLSNFVQE*LLN-RVDCFLCGR*VSCYYHRSAHCPQANQRRSK 29 F+ S FV++ +L +C CG V H HCP++++ R++ Sbjct: 921 FLRSYFVEKGILEGSPNCPECGDAVEDVEHVLFHCPRSDRIRNE 964 >AB090814-1|BAC57903.1| 499|Anopheles gambiae gag-like protein protein. Length = 499 Score = 23.8 bits (49), Expect = 2.6 Identities = 12/45 (26%), Positives = 22/45 (48%) Frame = +2 Query: 113 DPIQQLFLDKIREYKQKSSGGKLVDPSPAIQKRVESRAGKARETV 247 DP Q F ++ + +GG L + + Q ES +GK ++ + Sbjct: 292 DPELQSFGKQVVRIRSTKNGGLLFELKKSDQTECESFSGKIQQAI 336 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 348,948 Number of Sequences: 2352 Number of extensions: 4640 Number of successful extensions: 7 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 7 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 7 length of database: 563,979 effective HSP length: 58 effective length of database: 427,563 effective search space used: 35060166 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -