BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= S06A01NCLL0001_M21 (539 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value DQ138190-1|ABA03054.1| 135|Tribolium castaneum bursicon-like pr... 24 0.74 AM292372-1|CAL23184.2| 771|Tribolium castaneum gustatory recept... 23 2.3 AY043293-2|AAK96034.1| 353|Tribolium castaneum homeodomain tran... 21 6.9 AF231104-1|AAF64149.1| 142|Tribolium castaneum labial protein p... 21 6.9 AF231103-1|AAF64148.1| 142|Tribolium castaneum labial protein p... 21 6.9 >DQ138190-1|ABA03054.1| 135|Tribolium castaneum bursicon-like protein protein. Length = 135 Score = 24.2 bits (50), Expect = 0.74 Identities = 9/21 (42%), Positives = 16/21 (76%) Frame = +3 Query: 315 SYEYLKTLASDVHVVRGDFDE 377 S E +TL SD+++++ +FDE Sbjct: 22 SEETCETLMSDINLIKEEFDE 42 >AM292372-1|CAL23184.2| 771|Tribolium castaneum gustatory receptor candidate 51 protein. Length = 771 Score = 22.6 bits (46), Expect = 2.3 Identities = 16/48 (33%), Positives = 22/48 (45%), Gaps = 1/48 (2%) Frame = -1 Query: 515 KDINIELPLHQCQGLL-VTPGHNLMTMNEANTKLPNCYHLLLRVCCIL 375 KDI PL + + +TP ++ T + L CY LL V IL Sbjct: 10 KDIVFINPLVKYLNIFFITPWYDFPTNQKYYPSLAKCYACLLMVVKIL 57 >AY043293-2|AAK96034.1| 353|Tribolium castaneum homeodomain transcription factor Labialprotein. Length = 353 Score = 21.0 bits (42), Expect = 6.9 Identities = 7/16 (43%), Positives = 13/16 (81%) Frame = +2 Query: 71 TITIKSINAINSGRSN 118 T ++ S+N +N+GR+N Sbjct: 244 TSSMLSLNCLNTGRTN 259 >AF231104-1|AAF64149.1| 142|Tribolium castaneum labial protein protein. Length = 142 Score = 21.0 bits (42), Expect = 6.9 Identities = 7/16 (43%), Positives = 13/16 (81%) Frame = +2 Query: 71 TITIKSINAINSGRSN 118 T ++ S+N +N+GR+N Sbjct: 33 TSSMLSLNCLNTGRTN 48 >AF231103-1|AAF64148.1| 142|Tribolium castaneum labial protein protein. Length = 142 Score = 21.0 bits (42), Expect = 6.9 Identities = 7/16 (43%), Positives = 13/16 (81%) Frame = +2 Query: 71 TITIKSINAINSGRSN 118 T ++ S+N +N+GR+N Sbjct: 33 TSSMLSLNCLNTGRTN 48 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 141,662 Number of Sequences: 336 Number of extensions: 3244 Number of successful extensions: 5 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 5 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 5 length of database: 122,585 effective HSP length: 53 effective length of database: 104,777 effective search space used: 13201902 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -