BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= S06A01NCLL0001_M20 (484 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value EF592537-1|ABQ95983.1| 593|Tribolium castaneum beta-N-acetylglu... 25 0.28 DQ157471-1|AAZ85125.1| 1639|Tribolium castaneum Down Syndrome ad... 23 2.0 DQ490059-1|ABF22614.1| 947|Tribolium castaneum short gastrulati... 21 6.0 AM292361-1|CAL23173.2| 373|Tribolium castaneum gustatory recept... 21 6.0 AY800247-1|AAV66724.1| 790|Tribolium castaneum pangolin protein. 21 7.9 AY800246-1|AAV66723.1| 682|Tribolium castaneum pangolin protein. 21 7.9 >EF592537-1|ABQ95983.1| 593|Tribolium castaneum beta-N-acetylglucosaminidase NAG2 protein. Length = 593 Score = 25.4 bits (53), Expect = 0.28 Identities = 13/33 (39%), Positives = 16/33 (48%) Frame = -2 Query: 417 SDTFATLTTLNLTPGMSPTAWPLRPNPATNTSS 319 +DT+ TL T L G WP +P T SS Sbjct: 52 TDTYPTLETCRLVCGKYGALWP-QPTSVTKISS 83 >DQ157471-1|AAZ85125.1| 1639|Tribolium castaneum Down Syndrome adhesion molecule splicevariant 3.12.3.1 protein. Length = 1639 Score = 22.6 bits (46), Expect = 2.0 Identities = 8/11 (72%), Positives = 10/11 (90%) Frame = +2 Query: 353 GHAVGDIPGVR 385 G AVGD+PG+R Sbjct: 62 GTAVGDVPGLR 72 >DQ490059-1|ABF22614.1| 947|Tribolium castaneum short gastrulation protein. Length = 947 Score = 21.0 bits (42), Expect = 6.0 Identities = 7/18 (38%), Positives = 11/18 (61%) Frame = +1 Query: 313 GER*GVSCRIRS*RPRCW 366 GE V+C+ + +P CW Sbjct: 869 GEYKCVTCKCENGKPTCW 886 >AM292361-1|CAL23173.2| 373|Tribolium castaneum gustatory receptor candidate 40 protein. Length = 373 Score = 21.0 bits (42), Expect = 6.0 Identities = 9/34 (26%), Positives = 18/34 (52%) Frame = -2 Query: 318 FSSMWLRQPSRGTNAVTFLPFLMSCTRTHLRMAE 217 F+ +W + +RGT LP +C + L +++ Sbjct: 3 FAELWKKIRNRGTPPKFELPTTHNCLKKVLLLSQ 36 >AY800247-1|AAV66724.1| 790|Tribolium castaneum pangolin protein. Length = 790 Score = 20.6 bits (41), Expect = 7.9 Identities = 10/32 (31%), Positives = 12/32 (37%) Frame = -3 Query: 101 CRPIAARDDDSRACAPCEYPEVYPLR*REHDP 6 CR D ++ C PC E R H P Sbjct: 574 CRARYGLDQQNQWCKPCRPREQLTWRRNFHGP 605 >AY800246-1|AAV66723.1| 682|Tribolium castaneum pangolin protein. Length = 682 Score = 20.6 bits (41), Expect = 7.9 Identities = 10/32 (31%), Positives = 12/32 (37%) Frame = -3 Query: 101 CRPIAARDDDSRACAPCEYPEVYPLR*REHDP 6 CR D ++ C PC E R H P Sbjct: 466 CRARYGLDQQNQWCKPCRPREQLTWRRNFHGP 497 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 122,187 Number of Sequences: 336 Number of extensions: 2735 Number of successful extensions: 8 Number of sequences better than 10.0: 6 Number of HSP's better than 10.0 without gapping: 8 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 8 length of database: 122,585 effective HSP length: 52 effective length of database: 105,113 effective search space used: 11352204 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 40 (21.2 bits)
- SilkBase 1999-2023 -