BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= S06A01NCLL0001_M19 (258 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_23775| Best HMM Match : Tropomyosin (HMM E-Value=0) 35 0.012 SB_1091| Best HMM Match : Cupin_4 (HMM E-Value=0) 33 0.037 SB_51904| Best HMM Match : CH (HMM E-Value=0.0058) 33 0.048 SB_33399| Best HMM Match : Ank (HMM E-Value=0) 31 0.11 SB_1939| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 0.26 SB_47629| Best HMM Match : Vicilin_N (HMM E-Value=1.1) 30 0.26 SB_26345| Best HMM Match : DUF1531 (HMM E-Value=2.4) 30 0.26 SB_15756| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 0.34 SB_36590| Best HMM Match : FGF (HMM E-Value=10) 30 0.34 SB_33540| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 0.45 SB_18984| Best HMM Match : DNA_topoisoIV (HMM E-Value=0) 29 0.45 SB_11234| Best HMM Match : DSPc (HMM E-Value=2.4e-29) 29 0.45 SB_10690| Best HMM Match : Pkinase (HMM E-Value=6.4e-08) 29 0.45 SB_38133| Best HMM Match : TolA (HMM E-Value=0.38) 29 0.60 SB_11112| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 0.60 SB_10182| Best HMM Match : Transformer (HMM E-Value=9.9) 29 0.60 SB_37383| Best HMM Match : bZIP_2 (HMM E-Value=2.5e-06) 29 0.79 SB_37693| Best HMM Match : PHD (HMM E-Value=8.7e-35) 29 0.79 SB_36647| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 0.79 SB_47342| Best HMM Match : VWA (HMM E-Value=0) 28 1.0 SB_28665| Best HMM Match : TGF_beta (HMM E-Value=1.2e-22) 28 1.4 SB_47670| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 1.4 SB_864| Best HMM Match : Sulfotransfer_1 (HMM E-Value=6.4e-05) 28 1.4 SB_54435| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 1.8 SB_49054| Best HMM Match : Chordopox_A30L (HMM E-Value=4.1) 27 1.8 SB_32475| Best HMM Match : IWS1_C (HMM E-Value=0) 27 1.8 SB_50227| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 1.8 SB_42837| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 1.8 SB_36640| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 1.8 SB_35812| Best HMM Match : Atrophin-1 (HMM E-Value=0.23) 27 1.8 SB_26383| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 2.4 SB_36955| Best HMM Match : LISCH7 (HMM E-Value=9.8) 27 3.2 SB_34529| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 3.2 SB_32504| Best HMM Match : TolA (HMM E-Value=0.52) 27 3.2 SB_25625| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 3.2 SB_2606| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 3.2 SB_42091| Best HMM Match : E-MAP-115 (HMM E-Value=9.5) 26 4.2 SB_39966| Best HMM Match : CRA_rpt (HMM E-Value=8.6) 26 4.2 SB_30892| Best HMM Match : No HMM Matches (HMM E-Value=.) 26 4.2 SB_30234| Best HMM Match : No HMM Matches (HMM E-Value=.) 26 4.2 SB_26233| Best HMM Match : No HMM Matches (HMM E-Value=.) 26 4.2 SB_9795| Best HMM Match : FF (HMM E-Value=2.3e-33) 26 4.2 SB_37029| Best HMM Match : 7tm_1 (HMM E-Value=4.2039e-45) 26 4.2 SB_32355| Best HMM Match : Laminin_EGF (HMM E-Value=0) 26 4.2 SB_27758| Best HMM Match : No HMM Matches (HMM E-Value=.) 26 4.2 SB_57861| Best HMM Match : Ribosomal_S30 (HMM E-Value=2e-32) 26 5.6 SB_44883| Best HMM Match : PqqD (HMM E-Value=2.2) 26 5.6 SB_44098| Best HMM Match : No HMM Matches (HMM E-Value=.) 26 5.6 SB_36541| Best HMM Match : WD40 (HMM E-Value=0) 26 5.6 SB_33227| Best HMM Match : DEP (HMM E-Value=0.042) 26 5.6 SB_30893| Best HMM Match : No HMM Matches (HMM E-Value=.) 26 5.6 SB_23345| Best HMM Match : No HMM Matches (HMM E-Value=.) 26 5.6 SB_13998| Best HMM Match : Kringle (HMM E-Value=0.0016) 26 5.6 SB_7753| Best HMM Match : RVT_1 (HMM E-Value=0.089) 26 5.6 SB_40834| Best HMM Match : No HMM Matches (HMM E-Value=.) 26 5.6 SB_59580| Best HMM Match : No HMM Matches (HMM E-Value=.) 25 7.4 SB_52278| Best HMM Match : Ery_res_leader1 (HMM E-Value=0.94) 25 7.4 SB_35780| Best HMM Match : No HMM Matches (HMM E-Value=.) 25 7.4 SB_22653| Best HMM Match : No HMM Matches (HMM E-Value=.) 25 7.4 SB_19782| Best HMM Match : No HMM Matches (HMM E-Value=.) 25 7.4 SB_5351| Best HMM Match : No HMM Matches (HMM E-Value=.) 25 7.4 SB_57003| Best HMM Match : No HMM Matches (HMM E-Value=.) 25 7.4 SB_52978| Best HMM Match : No HMM Matches (HMM E-Value=.) 25 7.4 SB_46961| Best HMM Match : DUF663 (HMM E-Value=0) 25 7.4 SB_45707| Best HMM Match : No HMM Matches (HMM E-Value=.) 25 7.4 SB_45236| Best HMM Match : PRP38 (HMM E-Value=0) 25 7.4 SB_22224| Best HMM Match : No HMM Matches (HMM E-Value=.) 25 7.4 SB_8304| Best HMM Match : PLAT (HMM E-Value=0) 25 7.4 SB_910| Best HMM Match : Cation_efflux (HMM E-Value=0.056) 25 7.4 SB_236| Best HMM Match : QPP (HMM E-Value=1.8) 25 7.4 SB_51535| Best HMM Match : W2 (HMM E-Value=4e-29) 25 9.7 SB_49662| Best HMM Match : Bromodomain (HMM E-Value=9.8e-38) 25 9.7 SB_40929| Best HMM Match : Attractin (HMM E-Value=5.1) 25 9.7 SB_39463| Best HMM Match : U79_P34 (HMM E-Value=1.3) 25 9.7 SB_15757| Best HMM Match : No HMM Matches (HMM E-Value=.) 25 9.7 SB_8482| Best HMM Match : No HMM Matches (HMM E-Value=.) 25 9.7 SB_6334| Best HMM Match : zf-C2H2 (HMM E-Value=1.5e-26) 25 9.7 SB_540| Best HMM Match : No HMM Matches (HMM E-Value=.) 25 9.7 SB_43903| Best HMM Match : FHA (HMM E-Value=4.6e-13) 25 9.7 SB_32857| Best HMM Match : TolA (HMM E-Value=1.1) 25 9.7 SB_12387| Best HMM Match : No HMM Matches (HMM E-Value=.) 25 9.7 >SB_23775| Best HMM Match : Tropomyosin (HMM E-Value=0) Length = 442 Score = 34.7 bits (76), Expect = 0.012 Identities = 17/58 (29%), Positives = 35/58 (60%), Gaps = 2/58 (3%) Frame = +2 Query: 89 KRYQKTWEA*KLDVRRTTKKRENKKDDLTREMKVDAEKKRRKK--TANVEDRRQRSPK 256 +R +K E K + R KK+ +KD L ++ K + EK+++++ A +E++++R K Sbjct: 353 ERLEKQAEKEKKEKERLEKKQREEKDRLEKKEKKEEEKRKKEEEINAKIEEKKKREEK 410 >SB_1091| Best HMM Match : Cupin_4 (HMM E-Value=0) Length = 584 Score = 33.1 bits (72), Expect = 0.037 Identities = 17/53 (32%), Positives = 32/53 (60%) Frame = +2 Query: 89 KRYQKTWEA*KLDVRRTTKKRENKKDDLTREMKVDAEKKRRKKTANVEDRRQR 247 K+ +KT K+D ++T KK + K++ E K + EKK +KKT + ++++ Sbjct: 472 KKEKKTKNGGKVDGKKT-KKGKKKEESEEEEEKSEEEKKSKKKTKTKKGKKEK 523 >SB_51904| Best HMM Match : CH (HMM E-Value=0.0058) Length = 1187 Score = 32.7 bits (71), Expect = 0.048 Identities = 13/42 (30%), Positives = 27/42 (64%) Frame = +2 Query: 122 LDVRRTTKKRENKKDDLTREMKVDAEKKRRKKTANVEDRRQR 247 LD +KR+ ++++ R+ K+D EK ++K+ A ED +++ Sbjct: 924 LDEDEAKRKRQREEEEAKRKKKMDEEKAKKKELAAWEDAKRK 965 >SB_33399| Best HMM Match : Ank (HMM E-Value=0) Length = 1416 Score = 31.5 bits (68), Expect = 0.11 Identities = 13/35 (37%), Positives = 21/35 (60%) Frame = +2 Query: 131 RRTTKKRENKKDDLTREMKVDAEKKRRKKTANVED 235 RR KK++ KK LT++ V+ E K ++ +ED Sbjct: 730 RRRDKKKQKKKKKLTQDKDVETENKNNEEKEKLED 764 >SB_1939| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1646 Score = 30.3 bits (65), Expect = 0.26 Identities = 10/35 (28%), Positives = 24/35 (68%) Frame = +2 Query: 143 KKRENKKDDLTREMKVDAEKKRRKKTANVEDRRQR 247 K+RE ++ + ++ K+D EK+ R++ E++++R Sbjct: 184 KRREREQKEREKQQKLDMEKEERRRRQQEEEKKRR 218 Score = 27.1 bits (57), Expect = 2.4 Identities = 10/41 (24%), Positives = 25/41 (60%) Frame = +2 Query: 134 RTTKKRENKKDDLTREMKVDAEKKRRKKTANVEDRRQRSPK 256 R ++RE K+ + +++ ++ E++RR++ + RR+ K Sbjct: 183 RKRREREQKEREKQQKLDMEKEERRRRQQEEEKKRREEEEK 223 >SB_47629| Best HMM Match : Vicilin_N (HMM E-Value=1.1) Length = 599 Score = 30.3 bits (65), Expect = 0.26 Identities = 17/56 (30%), Positives = 31/56 (55%) Frame = +2 Query: 89 KRYQKTWEA*KLDVRRTTKKRENKKDDLTREMKVDAEKKRRKKTANVEDRRQRSPK 256 KR ++ E K + R+ +K+E KK+ R+ + EKK+ +K E+R++ K Sbjct: 30 KRDEREQEREKKERRKKERKKERKKE---RKKERKKEKKKERKKERKEERKKERKK 82 Score = 25.4 bits (53), Expect = 7.4 Identities = 15/44 (34%), Positives = 26/44 (59%), Gaps = 2/44 (4%) Frame = +2 Query: 122 LDVRRTTKKREN-KKDDLTREM-KVDAEKKRRKKTANVEDRRQR 247 +D R ++K R+ K+D+ +E K + KK RKK E +++R Sbjct: 17 IDGRWSSKTRKGGKRDEREQEREKKERRKKERKKERKKERKKER 60 >SB_26345| Best HMM Match : DUF1531 (HMM E-Value=2.4) Length = 169 Score = 30.3 bits (65), Expect = 0.26 Identities = 14/58 (24%), Positives = 32/58 (55%), Gaps = 4/58 (6%) Frame = +2 Query: 89 KRYQKTWEA*KLDVRRTTKKRENKK----DDLTREMKVDAEKKRRKKTANVEDRRQRS 250 K ++T E + + + KK++ +K +D+ +++ + KK++KK+ ED + S Sbjct: 93 KEQEETMEEQQTEATSSAKKKKKRKVEDVEDVEEKVEAETPKKKKKKSETTEDEIEES 150 Score = 27.1 bits (57), Expect = 2.4 Identities = 12/42 (28%), Positives = 26/42 (61%), Gaps = 4/42 (9%) Frame = +2 Query: 134 RTTKKRENKKDDLTREMKVDA----EKKRRKKTANVEDRRQR 247 R KK+E ++++ E + +A +KK+++K +VED ++ Sbjct: 86 RKKKKKEKEQEETMEEQQTEATSSAKKKKKRKVEDVEDVEEK 127 Score = 26.2 bits (55), Expect = 4.2 Identities = 9/35 (25%), Positives = 19/35 (54%) Frame = +2 Query: 131 RRTTKKRENKKDDLTREMKVDAEKKRRKKTANVED 235 ++ KK E +D++ + +KK++KK E+ Sbjct: 134 KKKKKKSETTEDEIEESINTSEKKKKKKKKKQTEE 168 >SB_15756| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 516 Score = 29.9 bits (64), Expect = 0.34 Identities = 19/53 (35%), Positives = 28/53 (52%) Frame = -3 Query: 163 FLVLPLFSCSSHVQFSGFPRFLVSFDQY*LSFRLLSSYDSLLVFSYEIVFFIL 5 F + P + S V+FS PR +S D+Y RL + SLL S +I+ +L Sbjct: 354 FNISPRQTRVSVVEFSSEPRLSISIDEYNSKTRLKCAVGSLLFESIQILPSVL 406 >SB_36590| Best HMM Match : FGF (HMM E-Value=10) Length = 208 Score = 29.9 bits (64), Expect = 0.34 Identities = 13/38 (34%), Positives = 23/38 (60%) Frame = +2 Query: 131 RRTTKKRENKKDDLTREMKVDAEKKRRKKTANVEDRRQ 244 ++T KR N K+ L + + + E+KRR K+ + R+Q Sbjct: 23 KQTPSKRSNSKEKLEKALPPNIERKRRAKSEVLFGRKQ 60 >SB_33540| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 252 Score = 29.5 bits (63), Expect = 0.45 Identities = 14/57 (24%), Positives = 30/57 (52%) Frame = +2 Query: 65 TET*LVLIKRYQKTWEA*KLDVRRTTKKRENKKDDLTREMKVDAEKKRRKKTANVED 235 T+T +K Y++TW++ + + T + D+L ++ V EK R + +++D Sbjct: 26 TDTDQASVKTYKETWKSIRKQLNDTKDSDDILFDELLEKLTVTEEKDRVQLLKSIDD 82 >SB_18984| Best HMM Match : DNA_topoisoIV (HMM E-Value=0) Length = 1182 Score = 29.5 bits (63), Expect = 0.45 Identities = 13/29 (44%), Positives = 21/29 (72%) Frame = +2 Query: 170 LTREMKVDAEKKRRKKTANVEDRRQRSPK 256 L++E K + K+R +K A +ED R++SPK Sbjct: 754 LSQEKKDELLKQRDQKAAELEDLRKKSPK 782 >SB_11234| Best HMM Match : DSPc (HMM E-Value=2.4e-29) Length = 2072 Score = 29.5 bits (63), Expect = 0.45 Identities = 14/58 (24%), Positives = 31/58 (53%) Frame = +2 Query: 83 LIKRYQKTWEA*KLDVRRTTKKRENKKDDLTREMKVDAEKKRRKKTANVEDRRQRSPK 256 L ++Y++ E + +R + KRE+K +DL + +K +++ +E+R + K Sbjct: 807 LREQYEQQLENTRAKLRESYDKREDKMEDLMESEITELREKHQQELGEMEERMKELQK 864 >SB_10690| Best HMM Match : Pkinase (HMM E-Value=6.4e-08) Length = 865 Score = 29.5 bits (63), Expect = 0.45 Identities = 18/53 (33%), Positives = 30/53 (56%) Frame = +2 Query: 89 KRYQKTWEA*KLDVRRTTKKRENKKDDLTREMKVDAEKKRRKKTANVEDRRQR 247 K +KT A R++K+R + +D+ RE + D+ +RR K+ + DRR R Sbjct: 322 KLREKTMVAPSKSPDRSSKRRSSSRDESARE-RPDSSYRRRSKSKS-PDRRSR 372 >SB_38133| Best HMM Match : TolA (HMM E-Value=0.38) Length = 2114 Score = 29.1 bits (62), Expect = 0.60 Identities = 14/40 (35%), Positives = 27/40 (67%), Gaps = 2/40 (5%) Frame = +2 Query: 143 KKRENKKDDLTREMKV--DAEKKRRKKTANVEDRRQRSPK 256 KK+EN+++D +E K + E+K++KK N E+ +++ K Sbjct: 1879 KKKENEEEDDKKEKKEENEEEEKKKKKKENEEEDDKKNNK 1918 Score = 26.6 bits (56), Expect = 3.2 Identities = 9/41 (21%), Positives = 25/41 (60%) Frame = +2 Query: 125 DVRRTTKKRENKKDDLTREMKVDAEKKRRKKTANVEDRRQR 247 D ++ KK+E +++ ++ K +KK+ ++ ++RR++ Sbjct: 1924 DEKKEKKKKEENEEEDDKKKKTKKKKKKEEEEQEEDERRRK 1964 Score = 26.2 bits (55), Expect = 4.2 Identities = 21/75 (28%), Positives = 37/75 (49%), Gaps = 2/75 (2%) Frame = +1 Query: 7 G*KTQFRKKKLIRNHKMTTDG-NLISIDQKIPKNVGSLKTGREKNN*KEGEQER*FNEGN 183 G K F+ +K + TD + I++ + K K E+ + K+ ++E NE Sbjct: 1842 GDKASFKLEKAGYKVEENTDSLGMAVIEKSLQKTFHPKKKENEEEDDKKEKKEE--NEEE 1899 Query: 184 ESRRRK-ETEKEDCK 225 E +++K E E+ED K Sbjct: 1900 EKKKKKKENEEEDDK 1914 Score = 25.4 bits (53), Expect = 7.4 Identities = 10/38 (26%), Positives = 21/38 (55%) Frame = +2 Query: 143 KKRENKKDDLTREMKVDAEKKRRKKTANVEDRRQRSPK 256 KK+EN+++D + K + E+ +K+ E+ + K Sbjct: 1904 KKKENEEEDDKKNNKEENEEDEKKEKKKKEENEEEDDK 1941 >SB_11112| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 464 Score = 29.1 bits (62), Expect = 0.60 Identities = 17/30 (56%), Positives = 20/30 (66%), Gaps = 2/30 (6%) Frame = +2 Query: 134 RTTKK-RENK-KDDLTREMKVDAEKKRRKK 217 RT KK RE + KD R K D+EKKRRK+ Sbjct: 142 RTEKKDREGRSKDKSQRRSKEDSEKKRRKR 171 >SB_10182| Best HMM Match : Transformer (HMM E-Value=9.9) Length = 245 Score = 29.1 bits (62), Expect = 0.60 Identities = 13/39 (33%), Positives = 22/39 (56%) Frame = +2 Query: 125 DVRRTTKKRENKKDDLTREMKVDAEKKRRKKTANVEDRR 241 D R++ K++ +KD +RE D +KR + + DRR Sbjct: 75 DNRKSEKEKYKEKDQRSRERDEDGHRKRDRDRRDDRDRR 113 >SB_37383| Best HMM Match : bZIP_2 (HMM E-Value=2.5e-06) Length = 222 Score = 28.7 bits (61), Expect = 0.79 Identities = 13/35 (37%), Positives = 22/35 (62%) Frame = +2 Query: 131 RRTTKKRENKKDDLTREMKVDAEKKRRKKTANVED 235 +RT +KR NK+ +L +E ++ EK+ + VED Sbjct: 169 KRTREKRRNKEQELLKEKEI-KEKENKALRTQVED 202 >SB_37693| Best HMM Match : PHD (HMM E-Value=8.7e-35) Length = 2049 Score = 28.7 bits (61), Expect = 0.79 Identities = 11/32 (34%), Positives = 20/32 (62%) Frame = +2 Query: 107 WEA*KLDVRRTTKKRENKKDDLTREMKVDAEK 202 WE +L + +KK K+D+L ++ VD++K Sbjct: 1277 WEMEELAMLTASKKEAEKRDELVKQESVDSQK 1308 >SB_36647| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 124 Score = 28.7 bits (61), Expect = 0.79 Identities = 13/42 (30%), Positives = 25/42 (59%) Frame = +2 Query: 131 RRTTKKRENKKDDLTREMKVDAEKKRRKKTANVEDRRQRSPK 256 ++ KK++ KK++ E + + E++RR+K RR+R K Sbjct: 19 KKKQKKQKKKKEEEEEEEEENEEEERRRKRRRRRRRRRRRRK 60 Score = 25.0 bits (52), Expect = 9.7 Identities = 12/56 (21%), Positives = 29/56 (51%) Frame = +2 Query: 89 KRYQKTWEA*KLDVRRTTKKRENKKDDLTREMKVDAEKKRRKKTANVEDRRQRSPK 256 K+ +K + K ++ KK+E ++++ + + +KRR++ RR++ K Sbjct: 9 KQKKKKKKRKKKKQKKQKKKKEEEEEEEEENEEEERRRKRRRRRRRRRRRRKKEKK 64 Score = 25.0 bits (52), Expect = 9.7 Identities = 15/62 (24%), Positives = 29/62 (46%) Frame = +1 Query: 25 RKKKLIRNHKMTTDGNLISIDQKIPKNVGSLKTGREKNN*KEGEQER*FNEGNESRRRKE 204 +KKK + + ++ +++ + K E+N +E E+E E NE R +KE Sbjct: 63 KKKKEEEEEEEEEETEAVNEEEEKIEETEKEKDEEEENEEEEEEEEDKVEERNEERLKKE 122 Query: 205 TE 210 + Sbjct: 123 KD 124 >SB_47342| Best HMM Match : VWA (HMM E-Value=0) Length = 483 Score = 28.3 bits (60), Expect = 1.0 Identities = 13/28 (46%), Positives = 18/28 (64%) Frame = -3 Query: 163 FLVLPLFSCSSHVQFSGFPRFLVSFDQY 80 FL+ P S + V +SG P+ +SFDQY Sbjct: 85 FLIQPGQSRAGVVLYSGNPKLSISFDQY 112 >SB_28665| Best HMM Match : TGF_beta (HMM E-Value=1.2e-22) Length = 350 Score = 27.9 bits (59), Expect = 1.4 Identities = 21/67 (31%), Positives = 30/67 (44%) Frame = +1 Query: 22 FRKKKLIRNHKMTTDGNLISIDQKIPKNVGSLKTGREKNN*KEGEQER*FNEGNESRRRK 201 F+ KKL+R + NL ++ +I N GSL E N K+ E ++ RR K Sbjct: 185 FKVKKLLREWRREPHKNL-GVEFEIEGNDGSLSLVTEGNEAKKPFLEVFTHDTGNKRRAK 243 Query: 202 ETEKEDC 222 DC Sbjct: 244 RRAGLDC 250 >SB_47670| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 566 Score = 27.9 bits (59), Expect = 1.4 Identities = 11/45 (24%), Positives = 24/45 (53%) Frame = +2 Query: 122 LDVRRTTKKRENKKDDLTREMKVDAEKKRRKKTANVEDRRQRSPK 256 L + +KR K ++ ++ K+ KKRR +++ E+ + P+ Sbjct: 129 LSAGKKIRKRHEKTTEMQKQTKMVPRKKRRVLSSSEEEEEEEEPQ 173 >SB_864| Best HMM Match : Sulfotransfer_1 (HMM E-Value=6.4e-05) Length = 524 Score = 27.9 bits (59), Expect = 1.4 Identities = 14/29 (48%), Positives = 20/29 (68%), Gaps = 1/29 (3%) Frame = +2 Query: 137 TTKKRENKKDDLTR-EMKVDAEKKRRKKT 220 T + + KKD ++ EMKVD EKK++ KT Sbjct: 380 TENQPKTKKDTESQPEMKVDPEKKKQSKT 408 >SB_54435| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 77 Score = 27.5 bits (58), Expect = 1.8 Identities = 20/65 (30%), Positives = 36/65 (55%), Gaps = 2/65 (3%) Frame = +2 Query: 59 QQTET*LVLIKRYQKTWEA*K--LDVRRTTKKRENKKDDLTREMKVDAEKKRRKKTANVE 232 Q+ + +IK ++T E K +V T ++E +K ++ E K+ EKK+RK+ E Sbjct: 2 QRQSANIEVIKDLKRTIEKIKRQAEVNARTYEKEVRKLNIKVE-KLKTEKKKRKELRQKE 60 Query: 233 DRRQR 247 +R+R Sbjct: 61 KKRRR 65 >SB_49054| Best HMM Match : Chordopox_A30L (HMM E-Value=4.1) Length = 432 Score = 27.5 bits (58), Expect = 1.8 Identities = 13/33 (39%), Positives = 20/33 (60%) Frame = +1 Query: 118 KTGREKNN*KEGEQER*FNEGNESRRRKETEKE 216 K+ REK KE + R +EG+ RRR+ +K+ Sbjct: 163 KSDREKEREKERRRRRHEDEGSGDRRRERRDKD 195 >SB_32475| Best HMM Match : IWS1_C (HMM E-Value=0) Length = 768 Score = 27.5 bits (58), Expect = 1.8 Identities = 12/35 (34%), Positives = 19/35 (54%) Frame = +2 Query: 125 DVRRTTKKRENKKDDLTREMKVDAEKKRRKKTANV 229 D R+TKK K D LTR++K + ++ N+ Sbjct: 662 DFVRSTKKTVTKADKLTRKLKDKKRANKMQRAVNI 696 >SB_50227| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 276 Score = 27.5 bits (58), Expect = 1.8 Identities = 11/39 (28%), Positives = 23/39 (58%) Frame = +2 Query: 140 TKKRENKKDDLTREMKVDAEKKRRKKTANVEDRRQRSPK 256 TKK++ KK ++ K +KK++KK + ++++ K Sbjct: 148 TKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKK 186 Score = 27.1 bits (57), Expect = 2.4 Identities = 11/40 (27%), Positives = 23/40 (57%) Frame = +2 Query: 137 TTKKRENKKDDLTREMKVDAEKKRRKKTANVEDRRQRSPK 256 T KK++ KK ++ K +KK++KK + ++++ K Sbjct: 148 TKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKK 187 Score = 26.6 bits (56), Expect = 3.2 Identities = 13/56 (23%), Positives = 28/56 (50%) Frame = +2 Query: 89 KRYQKTWEA*KLDVRRTTKKRENKKDDLTREMKVDAEKKRRKKTANVEDRRQRSPK 256 K+ +K + K ++ KK++ KK ++ K +KK++K+ E+ + K Sbjct: 149 KKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKEEEEEEEEEEEEEK 204 Score = 25.4 bits (53), Expect = 7.4 Identities = 12/52 (23%), Positives = 27/52 (51%) Frame = +2 Query: 89 KRYQKTWEA*KLDVRRTTKKRENKKDDLTREMKVDAEKKRRKKTANVEDRRQ 244 K+ +K + K ++ KK++ KK++ E + + E+K K+ E+ + Sbjct: 166 KKKKKKKKKKKKKKKKKKKKKKKKKEEEEEEEEEEEEEKEEKEEEEEEEEEE 217 >SB_42837| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 131 Score = 27.5 bits (58), Expect = 1.8 Identities = 12/42 (28%), Positives = 24/42 (57%) Frame = +2 Query: 125 DVRRTTKKRENKKDDLTREMKVDAEKKRRKKTANVEDRRQRS 250 DV + RE KK ++ K +KK++KK N ++++ ++ Sbjct: 6 DVPMRREYREEKKRKKKKQKKKKKKKKKKKKKKNKKNKKNKN 47 Score = 27.5 bits (58), Expect = 1.8 Identities = 12/41 (29%), Positives = 22/41 (53%) Frame = +2 Query: 134 RTTKKRENKKDDLTREMKVDAEKKRRKKTANVEDRRQRSPK 256 R KKR+ KK ++ K +KK+ KK +++ ++ K Sbjct: 14 REEKKRKKKKQKKKKKKKKKKKKKKNKKNKKNKNKNKKKKK 54 Score = 25.0 bits (52), Expect = 9.7 Identities = 12/48 (25%), Positives = 24/48 (50%) Frame = +2 Query: 89 KRYQKTWEA*KLDVRRTTKKRENKKDDLTREMKVDAEKKRRKKTANVE 232 K+ +K + K ++ KK++NKK+ + +K ++KK E Sbjct: 17 KKRKKKKQKKKKKKKKKKKKKKNKKNKKNKNKNKKKKKMKKKKEEEAE 64 >SB_36640| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 283 Score = 27.5 bits (58), Expect = 1.8 Identities = 11/38 (28%), Positives = 24/38 (63%) Frame = +2 Query: 143 KKRENKKDDLTREMKVDAEKKRRKKTANVEDRRQRSPK 256 ++ E ++++ E + + EK+RRKK + +R+R+ K Sbjct: 242 EEEEEEEEEEEEEEEEEEEKRRRKKKEKQKKKRKRNEK 279 Score = 25.0 bits (52), Expect = 9.7 Identities = 13/32 (40%), Positives = 18/32 (56%) Frame = +1 Query: 130 EKNN*KEGEQER*FNEGNESRRRKETEKEDCK 225 E+ +E E+E E E RRRK+ EK+ K Sbjct: 242 EEEEEEEEEEEEEEEEEEEKRRRKKKEKQKKK 273 >SB_35812| Best HMM Match : Atrophin-1 (HMM E-Value=0.23) Length = 4240 Score = 27.5 bits (58), Expect = 1.8 Identities = 18/42 (42%), Positives = 23/42 (54%), Gaps = 5/42 (11%) Frame = +2 Query: 146 KRENKKDDLTR----EMKVDAEKKRRKKTA-NVEDRRQRSPK 256 K ++KKDD T+ M V EKK KKTA N + +PK Sbjct: 2663 KEQDKKDDSTQVLPARMVVQDEKKEAKKTAENTWKKNVSNPK 2704 Score = 25.4 bits (53), Expect = 7.4 Identities = 14/43 (32%), Positives = 24/43 (55%) Frame = +2 Query: 89 KRYQKTWEA*KLDVRRTTKKRENKKDDLTREMKVDAEKKRRKK 217 +R+ + E K VR TK R ++ + TRE+ EKK+ ++ Sbjct: 2071 QRHARAKENWKKAVRVATKARRKQEVEKTREIIKQLEKKKSQE 2113 >SB_26383| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1142 Score = 27.1 bits (57), Expect = 2.4 Identities = 18/44 (40%), Positives = 27/44 (61%), Gaps = 3/44 (6%) Frame = +2 Query: 134 RTTKKRENK---KDDLTREMKVDAEKKRRKKTANVEDRRQRSPK 256 RT +K+E K K+D T E+ D EKKR+++ A E +R P+ Sbjct: 636 RTEEKQEEKVPEKEDKTEEL--DEEKKRQEENAK-EATPERKPE 676 >SB_36955| Best HMM Match : LISCH7 (HMM E-Value=9.8) Length = 160 Score = 26.6 bits (56), Expect = 3.2 Identities = 11/33 (33%), Positives = 20/33 (60%) Frame = +2 Query: 146 KRENKKDDLTREMKVDAEKKRRKKTANVEDRRQ 244 + + +K DL +EMK + E +RR K + +R+ Sbjct: 2 EEQKRKKDLEQEMKREKELRRRLKQQERQQKRE 34 >SB_34529| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 312 Score = 26.6 bits (56), Expect = 3.2 Identities = 11/35 (31%), Positives = 20/35 (57%) Frame = +2 Query: 143 KKRENKKDDLTREMKVDAEKKRRKKTANVEDRRQR 247 K ++K ++T+ K EKK++KK ++R R Sbjct: 23 KSTADEKLEVTKSKKAKREKKKKKKEKRKREKRTR 57 >SB_32504| Best HMM Match : TolA (HMM E-Value=0.52) Length = 422 Score = 26.6 bits (56), Expect = 3.2 Identities = 17/56 (30%), Positives = 26/56 (46%) Frame = +1 Query: 46 NHKMTTDGNLISIDQKIPKNVGSLKTGREKNN*KEGEQER*FNEGNESRRRKETEK 213 NH + + + I D+K K + K +EK K+ E+ + E R KE EK Sbjct: 114 NHSLLEEKD-IPRDKKSDKELKEEKKEKEKERMKKEEKHKEKTRKEEKEREKEKEK 168 Score = 26.2 bits (55), Expect = 4.2 Identities = 13/34 (38%), Positives = 23/34 (67%) Frame = +1 Query: 118 KTGREKNN*KEGEQER*FNEGNESRRRKETEKED 219 KT +E+ +E E+E+ E ESR +++T+KE+ Sbjct: 154 KTRKEEKE-REKEKEKTKKEEKESREKEKTKKEE 186 Score = 25.8 bits (54), Expect = 5.6 Identities = 14/53 (26%), Positives = 30/53 (56%) Frame = +1 Query: 58 TTDGNLISIDQKIPKNVGSLKTGREKNN*KEGEQER*FNEGNESRRRKETEKE 216 +T+ + + ++ IP++ S K +E+ KE E+ + + E R++E E+E Sbjct: 111 STENHSLLEEKDIPRDKKSDKELKEEKKEKEKERMKKEEKHKEKTRKEEKERE 163 >SB_25625| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 112 Score = 26.6 bits (56), Expect = 3.2 Identities = 8/16 (50%), Positives = 14/16 (87%) Frame = +1 Query: 178 GNESRRRKETEKEDCK 225 GN +RR++E +K+DC+ Sbjct: 8 GNSARRKREVKKQDCQ 23 >SB_2606| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1352 Score = 26.6 bits (56), Expect = 3.2 Identities = 10/36 (27%), Positives = 24/36 (66%) Frame = +2 Query: 134 RTTKKRENKKDDLTREMKVDAEKKRRKKTANVEDRR 241 R ++ E +D+LTRE+K++ ++ ++ + + +RR Sbjct: 986 RERQELEQAQDELTRELKLNKQEMAKRPVSAMGNRR 1021 >SB_42091| Best HMM Match : E-MAP-115 (HMM E-Value=9.5) Length = 274 Score = 26.2 bits (55), Expect = 4.2 Identities = 15/46 (32%), Positives = 22/46 (47%) Frame = +1 Query: 79 SIDQKIPKNVGSLKTGREKNN*KEGEQER*FNEGNESRRRKETEKE 216 S +++ K K RE+ +E E+ER E R +E EKE Sbjct: 86 STEERKKKKKKERKKVREREREREREREREKEREREREREREREKE 131 >SB_39966| Best HMM Match : CRA_rpt (HMM E-Value=8.6) Length = 159 Score = 26.2 bits (55), Expect = 4.2 Identities = 18/48 (37%), Positives = 26/48 (54%), Gaps = 2/48 (4%) Frame = +1 Query: 121 TGREKNN*KEGEQER*FNEGNESRRRK--ETEKEDCKC*RQKTAIAED 258 T +E KEGE E+ E+ +K ETEKE+ K ++KT E+ Sbjct: 1 TEKEGETEKEGETEKEGETEKEAETKKEAETEKEEEKETKKKTEKEEE 48 Score = 25.4 bits (53), Expect = 7.4 Identities = 14/36 (38%), Positives = 18/36 (50%) Frame = +1 Query: 118 KTGREKNN*KEGEQER*FNEGNESRRRKETEKEDCK 225 +T +E KEGE E+ E+ KE EKE K Sbjct: 6 ETEKEGETEKEGETEKEAETKKEAETEKEEEKETKK 41 >SB_30892| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 236 Score = 26.2 bits (55), Expect = 4.2 Identities = 14/53 (26%), Positives = 27/53 (50%), Gaps = 1/53 (1%) Frame = +2 Query: 101 KTWEA*KLDVRRTTKKR-ENKKDDLTREMKVDAEKKRRKKTANVEDRRQRSPK 256 + W+ K D RT ++R E +KD ++ K + + R++ +DR + K Sbjct: 30 REWKDRKTDNGRTVRQRMEGQKDREWKDRKTENGRTERQRMEGQKDREWKDRK 82 >SB_30234| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 5222 Score = 26.2 bits (55), Expect = 4.2 Identities = 12/33 (36%), Positives = 19/33 (57%) Frame = +2 Query: 134 RTTKKRENKKDDLTREMKVDAEKKRRKKTANVE 232 R ++ + K+ L RE+K D E + KTA+ E Sbjct: 4209 RHAEEAQRLKEKLERELKTDEEAAMQMKTADQE 4241 >SB_26233| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 463 Score = 26.2 bits (55), Expect = 4.2 Identities = 12/37 (32%), Positives = 22/37 (59%) Frame = +2 Query: 134 RTTKKRENKKDDLTREMKVDAEKKRRKKTANVEDRRQ 244 +TT++ E +K++ R+ + EK +KK E +RQ Sbjct: 274 QTTEEEEKQKEEAERKKQEKLEKLAKKKEELKERKRQ 310 Score = 25.0 bits (52), Expect = 9.7 Identities = 12/33 (36%), Positives = 19/33 (57%) Frame = +1 Query: 118 KTGREKNN*KEGEQER*FNEGNESRRRKETEKE 216 K +E+ KE E+ER E + + R+E EK+ Sbjct: 322 KERQEREKEKEREKERIQQEKEKQKERREKEKQ 354 >SB_9795| Best HMM Match : FF (HMM E-Value=2.3e-33) Length = 693 Score = 26.2 bits (55), Expect = 4.2 Identities = 15/30 (50%), Positives = 18/30 (60%) Frame = +1 Query: 127 REKNN*KEGEQER*FNEGNESRRRKETEKE 216 REK N +E E+ER E + R KE EKE Sbjct: 617 REKENDREREKER-EKEKEKEERDKEREKE 645 >SB_37029| Best HMM Match : 7tm_1 (HMM E-Value=4.2039e-45) Length = 1102 Score = 26.2 bits (55), Expect = 4.2 Identities = 11/45 (24%), Positives = 24/45 (53%) Frame = +2 Query: 119 KLDVRRTTKKRENKKDDLTREMKVDAEKKRRKKTANVEDRRQRSP 253 +L +R+ + ++ KK ++ K +KK++KK N + +P Sbjct: 362 ELRIRKPVRSKKKKKKKKKKKKKKKKKKKKKKKKKNSVELTMPAP 406 >SB_32355| Best HMM Match : Laminin_EGF (HMM E-Value=0) Length = 1358 Score = 26.2 bits (55), Expect = 4.2 Identities = 11/45 (24%), Positives = 24/45 (53%) Frame = +2 Query: 119 KLDVRRTTKKRENKKDDLTREMKVDAEKKRRKKTANVEDRRQRSP 253 +L +R+ + ++ KK ++ K +KK++KK N + +P Sbjct: 57 ELRIRKPVRSKKKKKKKKKKKKKKKKKKKKKKKKKNSVELTMPAP 101 >SB_27758| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1926 Score = 26.2 bits (55), Expect = 4.2 Identities = 13/47 (27%), Positives = 27/47 (57%), Gaps = 3/47 (6%) Frame = +2 Query: 119 KLDVRRTTKKRENKKDDLTRE---MKVDAEKKRRKKTANVEDRRQRS 250 K + + + +EN+ ++TR+ K+ E+ RRKK E R++++ Sbjct: 959 KKESDKQEESKENEGKEMTRKEKRKKIKEERNRRKKERKREKRKKKA 1005 >SB_57861| Best HMM Match : Ribosomal_S30 (HMM E-Value=2e-32) Length = 61 Score = 25.8 bits (54), Expect = 5.6 Identities = 10/20 (50%), Positives = 15/20 (75%) Frame = +2 Query: 185 KVDAEKKRRKKTANVEDRRQ 244 KVDA++K++KKT + R Q Sbjct: 19 KVDAQEKKKKKTGRAKRRMQ 38 >SB_44883| Best HMM Match : PqqD (HMM E-Value=2.2) Length = 83 Score = 25.8 bits (54), Expect = 5.6 Identities = 15/38 (39%), Positives = 22/38 (57%), Gaps = 2/38 (5%) Frame = +2 Query: 125 DVRRTTKKRENKKDDLTREMKVDAEKKRR--KKTANVE 232 D+RRT + EN +D L ++ ++KRR K AN E Sbjct: 41 DLRRTHNQIENLEDKLKIALETQQQEKRRYEDKIANDE 78 >SB_44098| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 561 Score = 25.8 bits (54), Expect = 5.6 Identities = 17/42 (40%), Positives = 22/42 (52%), Gaps = 2/42 (4%) Frame = +2 Query: 89 KRYQKTWEA*KLDVRRTTKKRENKKDDLTR--EMKVDAEKKR 208 K QKT E R T KK ++ K DLT+ K D+ K+R Sbjct: 273 KERQKTKERTSTKERDTNKKCDSTKRDLTKRDSTKRDSTKRR 314 >SB_36541| Best HMM Match : WD40 (HMM E-Value=0) Length = 1070 Score = 25.8 bits (54), Expect = 5.6 Identities = 13/39 (33%), Positives = 24/39 (61%), Gaps = 2/39 (5%) Frame = +2 Query: 125 DVRRTTKK--RENKKDDLTREMKVDAEKKRRKKTANVED 235 D R+ K+ ENK+DD+T ++++ + R+ K V+D Sbjct: 899 DERKVFKQLENENKRDDITGLIEMENQTVRQLKDLKVKD 937 >SB_33227| Best HMM Match : DEP (HMM E-Value=0.042) Length = 765 Score = 25.8 bits (54), Expect = 5.6 Identities = 14/48 (29%), Positives = 25/48 (52%), Gaps = 1/48 (2%) Frame = +2 Query: 107 WEA*KLDVRRTTKKRENKKDDLTRE-MKVDAEKKRRKKTANVEDRRQR 247 W VRR + +D + +K DAEK+ ++ A ++D+R+R Sbjct: 143 WGLHSKSVRRKSYHGFRSRDKMVASAVKDDAEKENDEQQAELDDKRKR 190 >SB_30893| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 171 Score = 25.8 bits (54), Expect = 5.6 Identities = 12/49 (24%), Positives = 27/49 (55%), Gaps = 1/49 (2%) Frame = +2 Query: 101 KTWEA*KLDVRRTTKKR-ENKKDDLTREMKVDAEKKRRKKTANVEDRRQ 244 + W+ K + RT ++R E +KD ++ K++ + R++ +DR + Sbjct: 122 REWKNRKTENGRTVRQRMEEQKDREWKDRKIENRRTERQRMEGQKDRME 170 >SB_23345| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 903 Score = 25.8 bits (54), Expect = 5.6 Identities = 12/53 (22%), Positives = 30/53 (56%) Frame = +2 Query: 89 KRYQKTWEA*KLDVRRTTKKRENKKDDLTREMKVDAEKKRRKKTANVEDRRQR 247 ++ +K EA + + RR ++ ++++ RE + +++ +K E+R+QR Sbjct: 432 EKERKKREAEEEEERRREEEERREEEERKREEEERKQREEEEKKREEEERKQR 484 >SB_13998| Best HMM Match : Kringle (HMM E-Value=0.0016) Length = 832 Score = 25.8 bits (54), Expect = 5.6 Identities = 12/35 (34%), Positives = 22/35 (62%) Frame = +2 Query: 146 KRENKKDDLTREMKVDAEKKRRKKTANVEDRRQRS 250 +RE+ +D+ R K + +RR+K +DRR+R+ Sbjct: 689 RREDSRDE--RRRKRERRDERRRKRGAEDDRRKRA 721 >SB_7753| Best HMM Match : RVT_1 (HMM E-Value=0.089) Length = 723 Score = 25.8 bits (54), Expect = 5.6 Identities = 12/56 (21%), Positives = 26/56 (46%) Frame = +2 Query: 83 LIKRYQKTWEA*KLDVRRTTKKRENKKDDLTREMKVDAEKKRRKKTANVEDRRQRS 250 L+K Y WEA +++ + E + + D EK+ +K ++ R+++ Sbjct: 469 LVKLYSAPWEAKSAALKKLHEDYEKEVYEAGTSTDTDMEKENLQKAKKLDAHRRKT 524 >SB_40834| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1299 Score = 25.8 bits (54), Expect = 5.6 Identities = 12/42 (28%), Positives = 21/42 (50%) Frame = +2 Query: 131 RRTTKKRENKKDDLTREMKVDAEKKRRKKTANVEDRRQRSPK 256 RR +KR K+ + + K+RRK+ + +R+R K Sbjct: 1138 RRRKRKRRRKRQRRRKRQRRRKRKRRRKRKRRRKRKRRRKRK 1179 Score = 25.4 bits (53), Expect = 7.4 Identities = 12/42 (28%), Positives = 21/42 (50%) Frame = +2 Query: 131 RRTTKKRENKKDDLTREMKVDAEKKRRKKTANVEDRRQRSPK 256 RR +KR K+ + + K+RRK+ + +R+R K Sbjct: 1060 RRRKRKRRRKRKRRRKRQRRRKRKRRRKRKRRRKRKRRRKRK 1101 Score = 25.4 bits (53), Expect = 7.4 Identities = 12/42 (28%), Positives = 21/42 (50%) Frame = +2 Query: 131 RRTTKKRENKKDDLTREMKVDAEKKRRKKTANVEDRRQRSPK 256 RR +KR K+ + + K+RRK+ + +R+R K Sbjct: 1066 RRRKRKRRRKRQRRRKRKRRRKRKRRRKRKRRRKRKRRRKRK 1107 Score = 25.4 bits (53), Expect = 7.4 Identities = 17/53 (32%), Positives = 26/53 (49%) Frame = +2 Query: 89 KRYQKTWEA*KLDVRRTTKKRENKKDDLTREMKVDAEKKRRKKTANVEDRRQR 247 KR +K K RR K+R +K R+ K ++KRR+K R++R Sbjct: 1143 KRRRKRQRRRKRQRRRKRKRRRKRKR--RRKRKRRRKRKRRRKRKRRRKRKRR 1193 Score = 25.0 bits (52), Expect = 9.7 Identities = 12/42 (28%), Positives = 21/42 (50%) Frame = +2 Query: 131 RRTTKKRENKKDDLTREMKVDAEKKRRKKTANVEDRRQRSPK 256 RR +KR K+ + + K+RRK+ + +R+R K Sbjct: 1048 RRRKRKRRRKRKRRRKRKRRRKRKRRRKRQRRRKRKRRRKRK 1089 Score = 25.0 bits (52), Expect = 9.7 Identities = 17/53 (32%), Positives = 26/53 (49%) Frame = +2 Query: 89 KRYQKTWEA*KLDVRRTTKKRENKKDDLTREMKVDAEKKRRKKTANVEDRRQR 247 KR +K K RR K+R +K R+ K ++KRR+K R++R Sbjct: 1065 KRRRKRKRRRKRQRRRKRKRRRKRKR--RRKRKRRRKRKRRRKRKRRRKRKRR 1115 Score = 25.0 bits (52), Expect = 9.7 Identities = 12/42 (28%), Positives = 21/42 (50%) Frame = +2 Query: 131 RRTTKKRENKKDDLTREMKVDAEKKRRKKTANVEDRRQRSPK 256 RR +KR K+ + + K+RRK+ + +R+R K Sbjct: 1090 RRRKRKRRRKRKRRRKRKRRRKRKRRRKRQRRRKRKRRRKRK 1131 Score = 25.0 bits (52), Expect = 9.7 Identities = 12/42 (28%), Positives = 21/42 (50%) Frame = +2 Query: 131 RRTTKKRENKKDDLTREMKVDAEKKRRKKTANVEDRRQRSPK 256 RR +KR K+ + + K+RRK+ + +R+R K Sbjct: 1102 RRRKRKRRRKRKRRRKRQRRRKRKRRRKRKRRRKRQRRRKRK 1143 Score = 25.0 bits (52), Expect = 9.7 Identities = 11/39 (28%), Positives = 21/39 (53%) Frame = +2 Query: 131 RRTTKKRENKKDDLTREMKVDAEKKRRKKTANVEDRRQR 247 +R K++ +K R+ K ++KRR+K R++R Sbjct: 1107 KRRRKRKRRRKRQRRRKRKRRRKRKRRRKRQRRRKRKRR 1145 Score = 25.0 bits (52), Expect = 9.7 Identities = 12/42 (28%), Positives = 21/42 (50%) Frame = +2 Query: 131 RRTTKKRENKKDDLTREMKVDAEKKRRKKTANVEDRRQRSPK 256 RR +KR K+ + + K+RRK+ + +R+R K Sbjct: 1120 RRRKRKRRRKRKRRRKRQRRRKRKRRRKRQRRRKRQRRRKRK 1161 Score = 25.0 bits (52), Expect = 9.7 Identities = 12/42 (28%), Positives = 21/42 (50%) Frame = +2 Query: 131 RRTTKKRENKKDDLTREMKVDAEKKRRKKTANVEDRRQRSPK 256 RR +KR K+ + + K+RRK+ + +R+R K Sbjct: 1156 RRRKRKRRRKRKRRRKRKRRRKRKRRRKRKRRRKRKRRRKRK 1197 Score = 25.0 bits (52), Expect = 9.7 Identities = 12/42 (28%), Positives = 21/42 (50%) Frame = +2 Query: 131 RRTTKKRENKKDDLTREMKVDAEKKRRKKTANVEDRRQRSPK 256 RR +KR K+ + + K+RRK+ + +R+R K Sbjct: 1162 RRRKRKRRRKRKRRRKRKRRRKRKRRRKRKRRRKRKRRRKRK 1203 Score = 25.0 bits (52), Expect = 9.7 Identities = 12/42 (28%), Positives = 21/42 (50%) Frame = +2 Query: 131 RRTTKKRENKKDDLTREMKVDAEKKRRKKTANVEDRRQRSPK 256 RR +KR K+ + + K+RRK+ + +R+R K Sbjct: 1168 RRRKRKRRRKRKRRRKRKRRRKRKRRRKRKRRRKRKRRRKRK 1209 Score = 25.0 bits (52), Expect = 9.7 Identities = 12/42 (28%), Positives = 21/42 (50%) Frame = +2 Query: 131 RRTTKKRENKKDDLTREMKVDAEKKRRKKTANVEDRRQRSPK 256 RR +KR K+ + + K+RRK+ + +R+R K Sbjct: 1174 RRRKRKRRRKRKRRRKRKRRRKRKRRRKRKRRRKRKRRRKRK 1215 Score = 25.0 bits (52), Expect = 9.7 Identities = 12/42 (28%), Positives = 21/42 (50%) Frame = +2 Query: 131 RRTTKKRENKKDDLTREMKVDAEKKRRKKTANVEDRRQRSPK 256 RR +KR K+ + + K+RRK+ + +R+R K Sbjct: 1180 RRRKRKRRRKRKRRRKRKRRRKRKRRRKRKRRRKRKRRRKRK 1221 Score = 25.0 bits (52), Expect = 9.7 Identities = 12/42 (28%), Positives = 21/42 (50%) Frame = +2 Query: 131 RRTTKKRENKKDDLTREMKVDAEKKRRKKTANVEDRRQRSPK 256 RR +KR K+ + + K+RRK+ + +R+R K Sbjct: 1186 RRRKRKRRRKRKRRRKRKRRRKRKRRRKRKRRRKRKRRRKRK 1227 Score = 25.0 bits (52), Expect = 9.7 Identities = 11/39 (28%), Positives = 21/39 (53%) Frame = +2 Query: 131 RRTTKKRENKKDDLTREMKVDAEKKRRKKTANVEDRRQR 247 +R K++ +K R+ K ++KRR+K ++ R R Sbjct: 1197 KRRRKRKRRRKRKRRRKRKRRRKRKRRRKRKSLMSRENR 1235 >SB_59580| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 999 Score = 25.4 bits (53), Expect = 7.4 Identities = 10/36 (27%), Positives = 21/36 (58%) Frame = +2 Query: 143 KKRENKKDDLTREMKVDAEKKRRKKTANVEDRRQRS 250 +K+E K ++ ++ K+R+ A EDR+Q++ Sbjct: 236 RKKELSKSEMKKKATPPVPKERKHLQAQEEDRKQKN 271 >SB_52278| Best HMM Match : Ery_res_leader1 (HMM E-Value=0.94) Length = 592 Score = 25.4 bits (53), Expect = 7.4 Identities = 13/44 (29%), Positives = 21/44 (47%) Frame = +2 Query: 122 LDVRRTTKKRENKKDDLTREMKVDAEKKRRKKTANVEDRRQRSP 253 LD+ EN+KDD+ +E + A R+ + E R+ P Sbjct: 103 LDILTKRVNEENEKDDIVQEWQYAATVLDRQGSQRGERERRHHP 146 >SB_35780| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 749 Score = 25.4 bits (53), Expect = 7.4 Identities = 10/24 (41%), Positives = 14/24 (58%) Frame = +1 Query: 52 KMTTDGNLISIDQKIPKNVGSLKT 123 K DGNL+ +IPKN+ +T Sbjct: 242 KHVADGNLLDAISRIPKNIRPART 265 >SB_22653| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 737 Score = 25.4 bits (53), Expect = 7.4 Identities = 14/41 (34%), Positives = 22/41 (53%), Gaps = 1/41 (2%) Frame = +2 Query: 131 RRTTKKRENKKDDLTR-EMKVDAEKKRRKKTANVEDRRQRS 250 R +K+R D + E K + E+K+R K+ E R+RS Sbjct: 198 REESKERRRHSDKAEKSERKREKEEKKRDKSEKRERSRERS 238 >SB_19782| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 728 Score = 25.4 bits (53), Expect = 7.4 Identities = 13/35 (37%), Positives = 21/35 (60%), Gaps = 4/35 (11%) Frame = +2 Query: 122 LDVRRTTKKRENKKDDLTREM----KVDAEKKRRK 214 LD+ + +K E KK+ L E+ K+DAE+ + K Sbjct: 209 LDILKIKRKEEKKKNKLLEEIISKVKIDAEEAKGK 243 >SB_5351| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 870 Score = 25.4 bits (53), Expect = 7.4 Identities = 10/31 (32%), Positives = 20/31 (64%) Frame = +2 Query: 125 DVRRTTKKRENKKDDLTREMKVDAEKKRRKK 217 D ++ ++ +D+L R+MK A+KK ++K Sbjct: 232 DSQKKRATQQALRDELERQMKEHAQKKEKEK 262 >SB_57003| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 682 Score = 25.4 bits (53), Expect = 7.4 Identities = 14/37 (37%), Positives = 18/37 (48%) Frame = +1 Query: 22 FRKKKLIRNHKMTTDGNLISIDQKIPKNVGSLKTGRE 132 F+KK I N+K + NL I + K GS K E Sbjct: 274 FKKKGRILNNKRDKEANLEEIGYHLTKTSGSSKDKSE 310 >SB_52978| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 879 Score = 25.4 bits (53), Expect = 7.4 Identities = 12/32 (37%), Positives = 20/32 (62%) Frame = +1 Query: 145 KEGEQER*FNEGNESRRRKETEKEDCKC*RQK 240 ++ E ER E E+R RK+ ++ED + R+K Sbjct: 522 RKREAERKIREEEEARLRKQKDEEDERTRREK 553 >SB_46961| Best HMM Match : DUF663 (HMM E-Value=0) Length = 491 Score = 25.4 bits (53), Expect = 7.4 Identities = 15/42 (35%), Positives = 22/42 (52%) Frame = +2 Query: 89 KRYQKTWEA*KLDVRRTTKKRENKKDDLTREMKVDAEKKRRK 214 KR E K+D +R TK+RE +K M AEK++ + Sbjct: 448 KRKVHRAEQAKIDSKRQTKRREERKK--VFRMMAQAEKRKSR 487 >SB_45707| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 730 Score = 25.4 bits (53), Expect = 7.4 Identities = 12/43 (27%), Positives = 25/43 (58%), Gaps = 2/43 (4%) Frame = +2 Query: 128 VRRTTKKRENKKDDLTREMKVDAEKK--RRKKTANVEDRRQRS 250 VR+ +K+++K+D + K A ++ R+ KT + D+ R+ Sbjct: 121 VRQARRKQQDKQDASNKTSKTQATRQASRKTKTRQLRDQAART 163 >SB_45236| Best HMM Match : PRP38 (HMM E-Value=0) Length = 381 Score = 25.4 bits (53), Expect = 7.4 Identities = 10/38 (26%), Positives = 20/38 (52%) Frame = +2 Query: 131 RRTTKKRENKKDDLTREMKVDAEKKRRKKTANVEDRRQ 244 RR ++ RE ++DD R + + K+R ++ R + Sbjct: 327 RRRSRSRERRRDDRKRRSRERSPKRRSREREESRSRHR 364 >SB_22224| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1106 Score = 25.4 bits (53), Expect = 7.4 Identities = 14/48 (29%), Positives = 26/48 (54%), Gaps = 2/48 (4%) Frame = +2 Query: 119 KLDVRRTTKKRE--NKKDDLTREMKVDAEKKRRKKTANVEDRRQRSPK 256 K D + ++RE KK+ ++ K + EK+ R++ E+ R+R K Sbjct: 987 KKDKEKEKRERELQRKKERDEQKRKKEEEKREREEKKRKEEERKRREK 1034 >SB_8304| Best HMM Match : PLAT (HMM E-Value=0) Length = 1182 Score = 25.4 bits (53), Expect = 7.4 Identities = 11/35 (31%), Positives = 21/35 (60%) Frame = +2 Query: 143 KKRENKKDDLTREMKVDAEKKRRKKTANVEDRRQR 247 K+ ENKK ++ EM+ E++ + E+R++R Sbjct: 615 KEIENKKKEIDDEMRKLEEERTERDRQKEEERKRR 649 >SB_910| Best HMM Match : Cation_efflux (HMM E-Value=0.056) Length = 416 Score = 25.4 bits (53), Expect = 7.4 Identities = 11/38 (28%), Positives = 20/38 (52%) Frame = +2 Query: 143 KKRENKKDDLTREMKVDAEKKRRKKTANVEDRRQRSPK 256 +KRE + D R+ K ++K RK+ E+ + + K Sbjct: 357 RKREKRDGDRQRDDKDRRDRKHRKREVEEEETKGKQTK 394 >SB_236| Best HMM Match : QPP (HMM E-Value=1.8) Length = 217 Score = 25.4 bits (53), Expect = 7.4 Identities = 14/53 (26%), Positives = 25/53 (47%) Frame = +2 Query: 89 KRYQKTWEA*KLDVRRTTKKRENKKDDLTREMKVDAEKKRRKKTANVEDRRQR 247 +R K+W + D +T K+ +NKK R+ +++R A +E R Sbjct: 123 QRTDKSWTEQEEDTEQT-KRGQNKKKTQNRQSVQRTRRRQRTDKAWIEQEEDR 174 >SB_51535| Best HMM Match : W2 (HMM E-Value=4e-29) Length = 770 Score = 25.0 bits (52), Expect = 9.7 Identities = 10/25 (40%), Positives = 16/25 (64%) Frame = +2 Query: 155 NKKDDLTREMKVDAEKKRRKKTANV 229 +KKDDLT+E + + +RK N+ Sbjct: 140 DKKDDLTQEEEEERGSTKRKMLGNI 164 >SB_49662| Best HMM Match : Bromodomain (HMM E-Value=9.8e-38) Length = 1301 Score = 25.0 bits (52), Expect = 9.7 Identities = 12/41 (29%), Positives = 26/41 (63%) Frame = +2 Query: 125 DVRRTTKKRENKKDDLTREMKVDAEKKRRKKTANVEDRRQR 247 +V + K +E KK+ ++ K++A+KKR++K +++R Sbjct: 80 EVSQEAKDKELKKE--KKKKKLEAKKKRKQKKKQKGKKKKR 118 >SB_40929| Best HMM Match : Attractin (HMM E-Value=5.1) Length = 566 Score = 25.0 bits (52), Expect = 9.7 Identities = 8/37 (21%), Positives = 25/37 (67%) Frame = +2 Query: 131 RRTTKKRENKKDDLTREMKVDAEKKRRKKTANVEDRR 241 R+T+K+++ +K + ++ ++ + + KT+N +D++ Sbjct: 486 RKTSKQQDAEKQEQAKQAARPSQARCKTKTSNPQDKQ 522 >SB_39463| Best HMM Match : U79_P34 (HMM E-Value=1.3) Length = 329 Score = 25.0 bits (52), Expect = 9.7 Identities = 12/34 (35%), Positives = 19/34 (55%), Gaps = 1/34 (2%) Frame = +2 Query: 119 KLDVRRT-TKKRENKKDDLTREMKVDAEKKRRKK 217 K V+RT +KR K+ E + D +KR++K Sbjct: 127 KTSVKRTKARKRSLKRQKRKNERQTDKRRKRKRK 160 Score = 25.0 bits (52), Expect = 9.7 Identities = 10/42 (23%), Positives = 24/42 (57%) Frame = +2 Query: 131 RRTTKKRENKKDDLTREMKVDAEKKRRKKTANVEDRRQRSPK 256 R+ + KR+ +K++ + + ++KR++K E+R S + Sbjct: 136 RKRSLKRQKRKNERQTDKRRKRKRKRKRKRNTSENRSNTSAR 177 >SB_15757| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 104 Score = 25.0 bits (52), Expect = 9.7 Identities = 14/36 (38%), Positives = 23/36 (63%), Gaps = 1/36 (2%) Frame = +1 Query: 124 GREKNN*KEGEQER*FNEGNESRRRKETEKED-CKC 228 G EK + ++ EQE+ E E++++ E E+ED C C Sbjct: 67 GEEKKDEEKKEQEKKIAE-KEAQKKVEQEEEDGCCC 101 >SB_8482| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 101 Score = 25.0 bits (52), Expect = 9.7 Identities = 14/40 (35%), Positives = 23/40 (57%) Frame = +1 Query: 100 KNVGSLKTGREKNN*KEGEQER*FNEGNESRRRKETEKED 219 K SLKT KN +E ++ +GN S+R E+E+++ Sbjct: 33 KKKNSLKTLIMKNETEERKKRTRLCQGNVSKRWSESERKN 72 >SB_6334| Best HMM Match : zf-C2H2 (HMM E-Value=1.5e-26) Length = 611 Score = 25.0 bits (52), Expect = 9.7 Identities = 10/19 (52%), Positives = 13/19 (68%) Frame = +2 Query: 185 KVDAEKKRRKKTANVEDRR 241 K D+EK +KT N ED+R Sbjct: 359 KADSEKSEDEKTTNSEDQR 377 >SB_540| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 253 Score = 25.0 bits (52), Expect = 9.7 Identities = 11/34 (32%), Positives = 19/34 (55%) Frame = +2 Query: 143 KKRENKKDDLTREMKVDAEKKRRKKTANVEDRRQ 244 ++ +K+D R+ K D K R K + E+RR+ Sbjct: 101 ERDRSKRDKKDRKEKRDRRSKERSKDESKEERRR 134 >SB_43903| Best HMM Match : FHA (HMM E-Value=4.6e-13) Length = 553 Score = 25.0 bits (52), Expect = 9.7 Identities = 14/44 (31%), Positives = 24/44 (54%) Frame = +2 Query: 86 IKRYQKTWEA*KLDVRRTTKKRENKKDDLTREMKVDAEKKRRKK 217 +KR + E+ ++ R EN+K+DL R +K EK ++K Sbjct: 195 LKRKESVMES---ELLRQKASLENEKEDLERSLKELLEKSPKEK 235 >SB_32857| Best HMM Match : TolA (HMM E-Value=1.1) Length = 448 Score = 25.0 bits (52), Expect = 9.7 Identities = 11/30 (36%), Positives = 18/30 (60%) Frame = +1 Query: 130 EKNN*KEGEQER*FNEGNESRRRKETEKED 219 E+NN +E + N+ +E RR +E K+D Sbjct: 171 ERNNEEEDRHDEERNDEHEDRRDEERNKKD 200 >SB_12387| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1096 Score = 25.0 bits (52), Expect = 9.7 Identities = 9/44 (20%), Positives = 24/44 (54%) Frame = +2 Query: 119 KLDVRRTTKKRENKKDDLTREMKVDAEKKRRKKTANVEDRRQRS 250 K D R +R +K+D+ + + + + ++ + + DR++R+ Sbjct: 328 KEDDNRRGGRRRQEKEDVNHQFRNERNAREKRDSRDRRDRKERT 371 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 6,844,414 Number of Sequences: 59808 Number of extensions: 112356 Number of successful extensions: 822 Number of sequences better than 10.0: 81 Number of HSP's better than 10.0 without gapping: 554 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 757 length of database: 16,821,457 effective HSP length: 62 effective length of database: 13,113,361 effective search space used: 301607303 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -