BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= S06A01NCLL0001_M19 (258 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At5g41320.1 68418.m05022 expressed protein 34 0.015 At3g28770.1 68416.m03591 expressed protein 31 0.080 At3g43590.1 68416.m04638 zinc knuckle (CCHC-type) family protein... 29 0.42 At5g55350.1 68418.m06897 membrane bound O-acyl transferase (MBOA... 29 0.56 At5g55370.1 68418.m06899 long-chain-alcohol O-fatty-acyltransfer... 28 0.74 At1g53720.1 68414.m06113 cyclophilin-RNA interacting protein, pu... 28 0.74 At1g29570.1 68414.m03616 zinc finger protein-related contains si... 28 0.74 At5g57120.1 68418.m07132 expressed protein weak similarity to SP... 28 0.98 At5g60030.1 68418.m07527 expressed protein 27 1.3 At5g54660.1 68418.m06806 heat shock protein-related contains wea... 27 1.3 At5g53880.1 68418.m06702 expressed protein 27 1.3 At5g08450.2 68418.m00996 expressed protein KED, Nicotiana tabacu... 27 1.3 At5g08450.1 68418.m00995 expressed protein KED, Nicotiana tabacu... 27 1.3 At3g57150.1 68416.m06363 dyskerin, putative / nucleolar protein ... 27 1.3 At2g45910.1 68415.m05709 protein kinase family protein / U-box d... 27 1.3 At5g15830.1 68418.m01852 bZIP transcription factor family protei... 27 1.7 At5g10570.1 68418.m01223 basic helix-loop-helix (bHLH) family pr... 27 1.7 At4g29790.1 68417.m04242 expressed protein 27 1.7 At2g42800.1 68415.m05299 leucine-rich repeat family protein cont... 27 1.7 At1g72150.1 68414.m08342 SEC14 cytosolic factor family protein /... 27 1.7 At5g60530.1 68418.m07590 late embryogenesis abundant protein-rel... 27 2.3 At5g55380.1 68418.m06900 membrane bound O-acyl transferase (MBOA... 27 2.3 At1g56660.1 68414.m06516 expressed protein 27 2.3 At1g20920.1 68414.m02619 DEAD box RNA helicase, putative similar... 27 2.3 At5g62440.1 68418.m07837 expressed protein 26 3.0 At5g17910.1 68418.m02100 expressed protein 26 3.0 At4g32420.1 68417.m04615 peptidyl-prolyl cis-trans isomerase cyc... 26 3.0 At5g45260.1 68418.m05555 disease resistance protein (TIR-NBS-LRR... 26 4.0 At5g41030.1 68418.m04987 TCP family transcription factor, putati... 26 4.0 At5g27120.1 68418.m03237 SAR DNA-binding protein, putative stron... 26 4.0 At4g08710.1 68417.m01439 hypothetical protein contains Pfam prof... 26 4.0 At3g52220.1 68416.m05737 expressed protein 26 4.0 At3g16840.1 68416.m02150 DEAD/DEAH box helicase, putative (RH13)... 26 4.0 At3g12860.1 68416.m01603 nucleolar protein Nop56, putative simil... 26 4.0 At2g19390.1 68415.m02262 expressed protein 26 4.0 At1g79140.1 68414.m09228 expressed protein 26 4.0 At1g21160.1 68414.m02646 eukaryotic translation initiation facto... 26 4.0 At5g65770.1 68418.m08276 nuclear matrix constituent protein-rela... 25 5.2 At5g63150.1 68418.m07929 expressed protein 25 5.2 At5g19300.1 68418.m02300 expressed protein contains Pfam profile... 25 5.2 At4g26630.1 68417.m03837 expressed protein 25 5.2 At1g71160.1 68414.m08211 beta-ketoacyl-CoA synthase family prote... 25 5.2 At4g22730.1 68417.m03279 leucine-rich repeat transmembrane prote... 25 6.9 At3g20550.1 68416.m02601 forkhead-associated domain-containing p... 25 6.9 At3g12640.1 68416.m01573 RNA recognition motif (RRM)-containing ... 25 6.9 At2g34880.1 68415.m04282 transcription factor jumonji (jmj) fami... 25 6.9 At2g28290.2 68415.m03434 chromatin remodeling protein, putative ... 25 6.9 At2g28290.1 68415.m03433 chromatin remodeling protein, putative ... 25 6.9 At1g80930.1 68414.m09495 MIF4G domain-containing protein / MA3 d... 25 6.9 At1g68880.1 68414.m07883 bZIP transcription factor family protei... 25 6.9 At5g65900.1 68418.m08295 DEAD/DEAH box helicase, putative contai... 25 9.1 At5g54030.1 68418.m06720 DC1 domain-containing protein contains ... 25 9.1 At5g41020.1 68418.m04986 myb family transcription factor contain... 25 9.1 At5g23750.2 68418.m02787 remorin family protein contains Pfam do... 25 9.1 At5g23750.1 68418.m02786 remorin family protein contains Pfam do... 25 9.1 At3g51070.1 68416.m05592 dehydration-responsive protein-related ... 25 9.1 At1g19390.1 68414.m02412 wall-associated kinase, putative simila... 25 9.1 >At5g41320.1 68418.m05022 expressed protein Length = 515 Score = 33.9 bits (74), Expect = 0.015 Identities = 16/36 (44%), Positives = 25/36 (69%) Frame = +2 Query: 140 TKKRENKKDDLTREMKVDAEKKRRKKTANVEDRRQR 247 T+KR +KKD+ T+ KV +KR+ KT VED +++ Sbjct: 63 TRKRRSKKDE-TKPEKVKQVRKRKPKTVCVEDNKKK 97 >At3g28770.1 68416.m03591 expressed protein Length = 2081 Score = 31.5 bits (68), Expect = 0.080 Identities = 14/56 (25%), Positives = 31/56 (55%) Frame = +2 Query: 89 KRYQKTWEA*KLDVRRTTKKRENKKDDLTREMKVDAEKKRRKKTANVEDRRQRSPK 256 K+ ++T E + + ++ KK + K+ + + MK + +KK +KK + R++ K Sbjct: 1062 KKEEETKEKKESENHKSKKKEDKKEHEDNKSMKKEEDKKEKKKHEESKSRKKEEDK 1117 Score = 28.3 bits (60), Expect = 0.74 Identities = 15/42 (35%), Positives = 23/42 (54%) Frame = +2 Query: 92 RYQKTWEA*KLDVRRTTKKRENKKDDLTREMKVDAEKKRRKK 217 R +K +E K + KK + K D RE K D+E+++ KK Sbjct: 1010 REKKEYEEKKSKTKEEAKKEKKKSQDKKREEK-DSEERKSKK 1050 Score = 24.6 bits (51), Expect = 9.1 Identities = 11/38 (28%), Positives = 25/38 (65%) Frame = +2 Query: 143 KKRENKKDDLTREMKVDAEKKRRKKTANVEDRRQRSPK 256 KK + K+ +++K + E+ R+K+T+ E+++Q+ K Sbjct: 1192 KKEKEMKESEEKKLKKN-EEDRKKQTSVEENKKQKETK 1228 >At3g43590.1 68416.m04638 zinc knuckle (CCHC-type) family protein contains Pfam domain, PF00098: Zinc knuckle Length = 551 Score = 29.1 bits (62), Expect = 0.42 Identities = 13/38 (34%), Positives = 21/38 (55%) Frame = +2 Query: 143 KKRENKKDDLTREMKVDAEKKRRKKTANVEDRRQRSPK 256 K +EN + D T KK++KK + E++ Q SP+ Sbjct: 394 KNKENSEHDSTPHESNGKTKKKKKKKTHKEEQPQTSPR 431 >At5g55350.1 68418.m06897 membrane bound O-acyl transferase (MBOAT) family protein / wax synthase-related contains similarity to wax synthase wax synthase - Simmondsia chinensis, PID:g5020219 similar to wax synthase [gi:5020219] from Simmondsia chinensis Length = 345 Score = 28.7 bits (61), Expect = 0.56 Identities = 18/53 (33%), Positives = 28/53 (52%) Frame = -3 Query: 247 SLSSVFNICSLLSPFLFGVYFHFPR*IIFLVLPLFSCSSHVQFSGFPRFLVSF 89 S+S + + + +F + P ++FLVLPLF S H FSG F +S+ Sbjct: 18 SISYCYYTSTRIKSGVFRLLSVLPVCVLFLVLPLFVSSVH--FSGSTAFFLSW 68 >At5g55370.1 68418.m06899 long-chain-alcohol O-fatty-acyltransferase family protein / wax synthase family protein contains similarity to wax synthase similarity to wax synthase wax synthase - Simmondsia chinensis, PID:g5020219 similar to wax synthase [gi:5020219] from Simmondsia chinensis Length = 343 Score = 28.3 bits (60), Expect = 0.74 Identities = 24/68 (35%), Positives = 32/68 (47%), Gaps = 9/68 (13%) Frame = -3 Query: 247 SLSSVFNICSLLSPFLFGVYFHFPR*IIFLVLPLFSCSSH---------VQFSGFPRFLV 95 S+S + I S +S + + P IIFL+LPLF S H + F FL Sbjct: 18 SISYCYYISSKISKGVLRLLSLLPIFIIFLLLPLFFSSVHFCVISGFFFTWLANFKLFLF 77 Query: 94 SFDQY*LS 71 +FDQ LS Sbjct: 78 AFDQEPLS 85 >At1g53720.1 68414.m06113 cyclophilin-RNA interacting protein, putative Length = 506 Score = 28.3 bits (60), Expect = 0.74 Identities = 12/41 (29%), Positives = 24/41 (58%) Frame = +2 Query: 125 DVRRTTKKRENKKDDLTREMKVDAEKKRRKKTANVEDRRQR 247 D R +K +K+ +RE + ++RR+++ + E RR+R Sbjct: 433 DARELERKHRERKERESREDEDRRRRRRREESRDKESRRER 473 >At1g29570.1 68414.m03616 zinc finger protein-related contains similarity to zinc finger proteins (CCCH type) Length = 321 Score = 28.3 bits (60), Expect = 0.74 Identities = 12/54 (22%), Positives = 31/54 (57%), Gaps = 1/54 (1%) Frame = +2 Query: 89 KRYQKTWEA*KLDVRRTTKKRENKKDDLTREMKVDA-EKKRRKKTANVEDRRQR 247 + + W + + R ++R +++L + + D+ E++RR+ N++++RQR Sbjct: 160 RHHDTEWRFERERMERIERQRREAEENLQEQRQRDSIERQRREAEENLQEQRQR 213 >At5g57120.1 68418.m07132 expressed protein weak similarity to SP|Q14978 Nucleolar phosphoprotein p130 {Homo sapiens} Length = 330 Score = 27.9 bits (59), Expect = 0.98 Identities = 15/37 (40%), Positives = 21/37 (56%), Gaps = 2/37 (5%) Frame = +2 Query: 125 DVRRTTKKRENKKDDLTREMKVD--AEKKRRKKTANV 229 D + +KKR+ + + T+E D E KRRKK NV Sbjct: 169 DKEKVSKKRKRSEPEETKEETEDDDEESKRRKKEENV 205 >At5g60030.1 68418.m07527 expressed protein Length = 292 Score = 27.5 bits (58), Expect = 1.3 Identities = 11/42 (26%), Positives = 27/42 (64%) Frame = +2 Query: 131 RRTTKKRENKKDDLTREMKVDAEKKRRKKTANVEDRRQRSPK 256 ++ KK++N KD+ + KV + + +K+A+ ++R+++ K Sbjct: 150 KKEKKKKKNNKDEDVVDEKVKEKLEDEQKSADRKERKKKKSK 191 >At5g54660.1 68418.m06806 heat shock protein-related contains weak similarity to 17.6 kDa class I heat shock protein (HSP 17.6) (Swiss-Prot:P13853) [Arabidopsis thaliana] Length = 192 Score = 27.5 bits (58), Expect = 1.3 Identities = 13/21 (61%), Positives = 14/21 (66%) Frame = -3 Query: 247 SLSSVFNICSLLSPFLFGVYF 185 S +VF SL SPFLFG YF Sbjct: 41 SEKAVFGEGSLFSPFLFGKYF 61 >At5g53880.1 68418.m06702 expressed protein Length = 66 Score = 27.5 bits (58), Expect = 1.3 Identities = 10/26 (38%), Positives = 20/26 (76%) Frame = +2 Query: 143 KKRENKKDDLTREMKVDAEKKRRKKT 220 KK+E KK+++ +E K + +K+ +K+T Sbjct: 35 KKKEVKKEEIKKEEKKEEKKEEKKET 60 >At5g08450.2 68418.m00996 expressed protein KED, Nicotiana tabacum, EMBL:AB009883 Length = 918 Score = 27.5 bits (58), Expect = 1.3 Identities = 11/39 (28%), Positives = 21/39 (53%) Frame = +2 Query: 89 KRYQKTWEA*KLDVRRTTKKRENKKDDLTREMKVDAEKK 205 +R WE +++ + + +E KD + RE + AEK+ Sbjct: 398 ERESDRWERERMEQKDRERNKEKDKDHIKREPRTGAEKE 436 >At5g08450.1 68418.m00995 expressed protein KED, Nicotiana tabacum, EMBL:AB009883 Length = 918 Score = 27.5 bits (58), Expect = 1.3 Identities = 11/39 (28%), Positives = 21/39 (53%) Frame = +2 Query: 89 KRYQKTWEA*KLDVRRTTKKRENKKDDLTREMKVDAEKK 205 +R WE +++ + + +E KD + RE + AEK+ Sbjct: 398 ERESDRWERERMEQKDRERNKEKDKDHIKREPRTGAEKE 436 >At3g57150.1 68416.m06363 dyskerin, putative / nucleolar protein NAP57, putative similar to SP|P40615 Dyskerin (Nucleolar protein NAP57) {Rattus norvegicus}; contains Pfam profiles PF01509: TruB family pseudouridylate synthase (N terminal domain), PF01472: PUA domain; supporting cDNA gi|8901185|gb|AF234984.2|AF234984 Length = 565 Score = 27.5 bits (58), Expect = 1.3 Identities = 11/35 (31%), Positives = 25/35 (71%), Gaps = 1/35 (2%) Frame = +2 Query: 131 RRTTKKRENKKDDLTREM-KVDAEKKRRKKTANVE 232 ++ KK+++KK+++ E+ +EKK++KK+ + E Sbjct: 496 KKEKKKKKDKKEEVIEEVASPKSEKKKKKKSKDTE 530 Score = 24.6 bits (51), Expect = 9.1 Identities = 9/28 (32%), Positives = 19/28 (67%) Frame = +2 Query: 134 RTTKKRENKKDDLTREMKVDAEKKRRKK 217 +++KK++ K + +E + +EKK +KK Sbjct: 474 KSSKKKKKKDKEEEKEEEAGSEKKEKKK 501 >At2g45910.1 68415.m05709 protein kinase family protein / U-box domain-containing protein contains Pfam profiles PF00069 Eukaryotic protein kinase domain, PF04564: U-box domain; supported by tandem duplication of (GI:3386604) (TIGR_Ath1:At2g45920) [Arabidopsis thaliana] Length = 834 Score = 27.5 bits (58), Expect = 1.3 Identities = 15/60 (25%), Positives = 30/60 (50%) Frame = +1 Query: 28 KKKLIRNHKMTTDGNLISIDQKIPKNVGSLKTGREKNN*KEGEQER*FNEGNESRRRKET 207 +K ++ + +DG + ++QK+ V L+ R++ + E++R E E R ET Sbjct: 398 QKAMLESQIAKSDGTMEKLNQKLDIAVKLLQKLRDEREELQTERDRALREAEELRSHAET 457 >At5g15830.1 68418.m01852 bZIP transcription factor family protein similar to common plant regulatory factor 7 GI:9650828 from [Petroselinum crispum]; contains Pfam profile: PF00170 bZIP transcription factor Length = 186 Score = 27.1 bits (57), Expect = 1.7 Identities = 15/47 (31%), Positives = 24/47 (51%), Gaps = 1/47 (2%) Frame = +2 Query: 119 KLDVRRTTKKRENKKDDLTREMKVDAEKKRRKKTANVED-RRQRSPK 256 +L+++ DD T E+ V E+K+R+ +N E RR R K Sbjct: 47 ELNLQSPVSNNSTTSDDATEEIFVINERKQRRMVSNRESARRSRMRK 93 >At5g10570.1 68418.m01223 basic helix-loop-helix (bHLH) family protein bHLH transcription factor, Arabidopsis thaliana, EMBL:AC005167 Length = 315 Score = 27.1 bits (57), Expect = 1.7 Identities = 12/32 (37%), Positives = 19/32 (59%) Frame = +2 Query: 122 LDVRRTTKKRENKKDDLTREMKVDAEKKRRKK 217 + + T KKR NKK + + AE++RRK+ Sbjct: 131 ISIGETNKKRSNKKLEGQPSKNLMAERRRRKR 162 >At4g29790.1 68417.m04242 expressed protein Length = 1211 Score = 27.1 bits (57), Expect = 1.7 Identities = 13/34 (38%), Positives = 19/34 (55%) Frame = +1 Query: 82 IDQKIPKNVGSLKTGREKNN*KEGEQER*FNEGN 183 I IP+ + LK G +NN K E+ + FNE + Sbjct: 111 IPSPIPEEIKRLKAGLRENNVKARERLKIFNEAS 144 >At2g42800.1 68415.m05299 leucine-rich repeat family protein contains leucine rich-repeat domains Pfam:PF00560, INTERPRO:IPR001611; and grail Length = 462 Score = 27.1 bits (57), Expect = 1.7 Identities = 12/27 (44%), Positives = 16/27 (59%) Frame = -3 Query: 241 SSVFNICSLLSPFLFGVYFHFPR*IIF 161 SS+F + L S F F + HFP I+F Sbjct: 106 SSIFTLPFLQSVFFFNCFTHFPTTIMF 132 >At1g72150.1 68414.m08342 SEC14 cytosolic factor family protein / phosphoglyceride transfer family protein similar to SEC14-like protein 2 (Alpha-tocopherol associated protein) (TAP) (bTAP) (Fragment) (SP:P58875) {Bos taurus}; similar to GI:807956 from [Saccharomyces cerevisiae]; contains Pfam PF00650 : CRAL/TRIO domain; contains Pfam PF03765 : CRAL/TRIO, N-terminus Length = 573 Score = 27.1 bits (57), Expect = 1.7 Identities = 13/35 (37%), Positives = 21/35 (60%) Frame = +2 Query: 98 QKTWEA*KLDVRRTTKKRENKKDDLTREMKVDAEK 202 +KT E + + +K E KK++ T E+KV+ EK Sbjct: 123 EKTEEKKTEEETKEEEKTEEKKEETTTEVKVEEEK 157 >At5g60530.1 68418.m07590 late embryogenesis abundant protein-related / LEA protein-related similar to late embryogenesis abundant protein [Picea glauca] GI:1350543 Length = 439 Score = 26.6 bits (56), Expect = 2.3 Identities = 15/49 (30%), Positives = 25/49 (51%), Gaps = 1/49 (2%) Frame = +2 Query: 101 KTWEA*KLDVRRTTK-KRENKKDDLTREMKVDAEKKRRKKTANVEDRRQ 244 K E K D + K K+E +K D + K D E+K ++K +E ++ Sbjct: 59 KDKEQEKKDKEKAAKDKKEKEKKDKEEKEKKDKERKEKEKKDKLEKEKK 107 >At5g55380.1 68418.m06900 membrane bound O-acyl transferase (MBOAT) family protein / wax synthase-related similar to wax synthase [gi:5020219] from Simmondsia chinensis Length = 341 Score = 26.6 bits (56), Expect = 2.3 Identities = 18/38 (47%), Positives = 22/38 (57%), Gaps = 1/38 (2%) Frame = -3 Query: 247 SLSSVFNICSLLSPFLFGVYFHFPR*IIFLVLPLF-SC 137 SLS + I S LS + + P I+FLVLPLF SC Sbjct: 18 SLSYCYYISSKLSKGVLRLLSILPVCILFLVLPLFLSC 55 >At1g56660.1 68414.m06516 expressed protein Length = 522 Score = 26.6 bits (56), Expect = 2.3 Identities = 11/44 (25%), Positives = 24/44 (54%) Frame = +2 Query: 125 DVRRTTKKRENKKDDLTREMKVDAEKKRRKKTANVEDRRQRSPK 256 D ++ KK +++ ++ K D EKK + ++ ED++ + K Sbjct: 246 DSKKNKKKEKDESCAEEKKKKPDKEKKEKDESTEKEDKKLKGKK 289 Score = 25.4 bits (53), Expect = 5.2 Identities = 10/44 (22%), Positives = 26/44 (59%) Frame = +2 Query: 125 DVRRTTKKRENKKDDLTREMKVDAEKKRRKKTANVEDRRQRSPK 256 D ++ KK +++ ++ K EKK+++++ + ED++ + K Sbjct: 173 DGKKNKKKEKDESGTEEKKKKPKKEKKQKEESKSNEDKKVKGKK 216 Score = 25.4 bits (53), Expect = 5.2 Identities = 11/46 (23%), Positives = 24/46 (52%) Frame = +2 Query: 119 KLDVRRTTKKRENKKDDLTREMKVDAEKKRRKKTANVEDRRQRSPK 256 K D+ + ++++ + D+ +EMK KK +KK + ++ K Sbjct: 221 KGDLEKEDEEKKKEHDETDQEMKEKDSKKNKKKEKDESCAEEKKKK 266 >At1g20920.1 68414.m02619 DEAD box RNA helicase, putative similar to RNA helicase [Rattus norvegicus] GI:897915; contains Pfam profiles PF00270: DEAD/DEAH box helicase, PF00271: Helicase conserved C-terminal domain Length = 1166 Score = 26.6 bits (56), Expect = 2.3 Identities = 14/36 (38%), Positives = 19/36 (52%) Frame = +1 Query: 118 KTGREKNN*KEGEQER*FNEGNESRRRKETEKEDCK 225 K RE+ K+ E+ER + R R+E EKE K Sbjct: 135 KRDREREERKDKEREREKDRERREREREEREKERVK 170 Score = 25.4 bits (53), Expect = 5.2 Identities = 14/39 (35%), Positives = 23/39 (58%) Frame = +2 Query: 131 RRTTKKRENKKDDLTREMKVDAEKKRRKKTANVEDRRQR 247 R++ + KK+ TRE +++ E+K K VE RR+R Sbjct: 249 RKSVEDNGEKKEKKTREEELEDEQK--KLDEEVEKRRRR 285 >At5g62440.1 68418.m07837 expressed protein Length = 202 Score = 26.2 bits (55), Expect = 3.0 Identities = 14/45 (31%), Positives = 24/45 (53%) Frame = +1 Query: 82 IDQKIPKNVGSLKTGREKNN*KEGEQER*FNEGNESRRRKETEKE 216 +D ++ +TG EK +E E+E G ES+++K E+E Sbjct: 21 VDMEVETATPKAETGDEKREREETEEE---ENGGESKKQKVGEEE 62 >At5g17910.1 68418.m02100 expressed protein Length = 1342 Score = 26.2 bits (55), Expect = 3.0 Identities = 14/47 (29%), Positives = 24/47 (51%) Frame = +1 Query: 79 SIDQKIPKNVGSLKTGREKNN*KEGEQER*FNEGNESRRRKETEKED 219 S D+ + + S G E +N E E+E E E ++ K+ +K+D Sbjct: 303 SSDEGMESDGDSESHGEEGDNENEDEEEDEEEEDEEEKQEKKEDKDD 349 >At4g32420.1 68417.m04615 peptidyl-prolyl cis-trans isomerase cyclophilin-type family protein weak similarity to CARS-Cyp [Homo sapiens] GI:1117968; contains Pfam profile PF00160: peptidyl-prolyl cis-trans isomerase, cyclophilin-type Length = 837 Score = 26.2 bits (55), Expect = 3.0 Identities = 15/43 (34%), Positives = 23/43 (53%), Gaps = 2/43 (4%) Frame = +2 Query: 131 RRTTKKRENKKDDLTREMKVDA--EKKRRKKTANVEDRRQRSP 253 R+ +KR +KKD R + D EKKR + + + +RSP Sbjct: 243 RQKKRKRSSKKDKHRRSKQRDKRHEKKRSMRDKRPKRKSRRSP 285 >At5g45260.1 68418.m05555 disease resistance protein (TIR-NBS-LRR class), putative domain signature TIR-NBS-LRR exists, suggestive of a disease resistance protein. Length = 1187 Score = 25.8 bits (54), Expect = 4.0 Identities = 12/20 (60%), Positives = 12/20 (60%) Frame = -3 Query: 157 VLPLFSCSSHVQFSGFPRFL 98 VL L CSS GFPRFL Sbjct: 750 VLDLSGCSSLNSIQGFPRFL 769 >At5g41030.1 68418.m04987 TCP family transcription factor, putative similar to PCF1 (GI:2580438) and PCF2 [(GI:2580440) Oryza sativa] ; similar to unknown protein (emb|CAB61988.1) Length = 243 Score = 25.8 bits (54), Expect = 4.0 Identities = 17/55 (30%), Positives = 29/55 (52%), Gaps = 2/55 (3%) Frame = +2 Query: 89 KRYQKTWEA*KLDVRRTTKKRENKKDDLTREMKVDAEKKRRKKTAN--VEDRRQR 247 KR Q + + V KK+EN+++D ++ + EKK+ K + VE R +R Sbjct: 27 KRKQTEVKGFDIVVGEKRKKKENEEEDQEIQILYEKEKKKPNKDRHLKVEGRGRR 81 >At5g27120.1 68418.m03237 SAR DNA-binding protein, putative strong similarity to SAR DNA-binding protein-1 [Pisum sativum] GI:3132696; contains Pfam profile PF01798: Putative snoRNA binding domain Length = 533 Score = 25.8 bits (54), Expect = 4.0 Identities = 9/30 (30%), Positives = 20/30 (66%) Frame = +2 Query: 131 RRTTKKRENKKDDLTREMKVDAEKKRRKKT 220 ++ +K E ++ ++ + K +EKK++KKT Sbjct: 502 KKKKRKHEEEETEMPAKKKEKSEKKKKKKT 531 >At4g08710.1 68417.m01439 hypothetical protein contains Pfam profile PF03384: Drosophila protein of unknown function, DUF287 Length = 715 Score = 25.8 bits (54), Expect = 4.0 Identities = 14/46 (30%), Positives = 25/46 (54%) Frame = +1 Query: 79 SIDQKIPKNVGSLKTGREKNN*KEGEQER*FNEGNESRRRKETEKE 216 S+ ++ P+NV ++ E+ +E E+E EG E +E E+E Sbjct: 73 SLTEQDPENVEEEESEEEEKEEEEKEEEE-EEEGEEEEEEEEEEEE 117 >At3g52220.1 68416.m05737 expressed protein Length = 237 Score = 25.8 bits (54), Expect = 4.0 Identities = 12/38 (31%), Positives = 19/38 (50%) Frame = +2 Query: 143 KKRENKKDDLTREMKVDAEKKRRKKTANVEDRRQRSPK 256 K E+ DD+ R+ K D ++R+ E+R R K Sbjct: 166 KTVEDGPDDVERDQKKDRREERKPAKREKEERHDRREK 203 >At3g16840.1 68416.m02150 DEAD/DEAH box helicase, putative (RH13) similar to RNA helicase GB:CAA09204 from [Arabidopsis thaliana]; identical to cDNA DEAD box RNA helicase, RH13 GI:3776002 Length = 832 Score = 25.8 bits (54), Expect = 4.0 Identities = 10/26 (38%), Positives = 18/26 (69%) Frame = +2 Query: 140 TKKRENKKDDLTREMKVDAEKKRRKK 217 T+K++ KK +E K + +KK++KK Sbjct: 130 TRKKKEKKAKRNKEKKKEKKKKKQKK 155 >At3g12860.1 68416.m01603 nucleolar protein Nop56, putative similar to XNop56 protein [Xenopus laevis] GI:14799394; contains Pfam profile PF01798: Putative snoRNA binding domain Length = 499 Score = 25.8 bits (54), Expect = 4.0 Identities = 11/35 (31%), Positives = 21/35 (60%) Frame = +2 Query: 128 VRRTTKKRENKKDDLTREMKVDAEKKRRKKTANVE 232 V + KK++ K ++ E + + KK++KK+ VE Sbjct: 441 VDASEKKKKRKTEEKEEEKEEEKSKKKKKKSKAVE 475 Score = 25.4 bits (53), Expect = 5.2 Identities = 11/45 (24%), Positives = 22/45 (48%) Frame = +2 Query: 122 LDVRRTTKKRENKKDDLTREMKVDAEKKRRKKTANVEDRRQRSPK 256 +DV + + KKD+ + + +KK+RK E++ + K Sbjct: 421 VDVMKEVLENLEKKDEGEKTVDASEKKKKRKTEEKEEEKEEEKSK 465 >At2g19390.1 68415.m02262 expressed protein Length = 1211 Score = 25.8 bits (54), Expect = 4.0 Identities = 12/34 (35%), Positives = 18/34 (52%) Frame = +1 Query: 82 IDQKIPKNVGSLKTGREKNN*KEGEQER*FNEGN 183 I IP+ + K G +NN K E+ + FNE + Sbjct: 110 IPSPIPEEIKRFKAGLRENNVKARERVKIFNEAS 143 >At1g79140.1 68414.m09228 expressed protein Length = 311 Score = 25.8 bits (54), Expect = 4.0 Identities = 14/37 (37%), Positives = 22/37 (59%), Gaps = 1/37 (2%) Frame = +2 Query: 149 RENKKDDLTR-EMKVDAEKKRRKKTANVEDRRQRSPK 256 R+ K+D+ R E+ EKK KK NV ++ ++PK Sbjct: 270 RDIKEDERVRMELLQSEEKKPLKKQNNVVKKKLKNPK 306 >At1g21160.1 68414.m02646 eukaryotic translation initiation factor 2 family protein / eIF-2 family protein similar to SP|O60841 Translation initiation factor IF-2 {Homo sapiens}; contains Pfam profiles PF00009: Elongation factor Tu GTP binding domain, PF03144: Elongation factor Tu domain 2 Length = 1088 Score = 25.8 bits (54), Expect = 4.0 Identities = 17/59 (28%), Positives = 31/59 (52%), Gaps = 4/59 (6%) Frame = +1 Query: 85 DQKIPKNVG----SLKTGREKNN*KEGEQER*FNEGNESRRRKETEKEDCKC*RQKTAI 249 ++K+PK+V +L +E + K+ E+E + E RR +E + + + RQK I Sbjct: 215 EKKVPKHVREKQETLARWKEAEDGKKKEEEERLRKEEEERRIEEEREREAEEIRQKRKI 273 >At5g65770.1 68418.m08276 nuclear matrix constituent protein-related low similarity to nuclear matrix constituent protein 1 (NMCP1) [Daucus carota] GI:2190187 Length = 1042 Score = 25.4 bits (53), Expect = 5.2 Identities = 13/57 (22%), Positives = 33/57 (57%), Gaps = 2/57 (3%) Frame = +2 Query: 80 VLIKRYQKTWEA*KLDVRRTTKKRENKKDDLTREMKVDAEKKR--RKKTANVEDRRQ 244 V I+ ++ WE ++D+++ K+ DL + + AEK++ +K+ N++++ + Sbjct: 406 VEIESKRRAWELREVDIKQREDLVGEKEHDLEVQSRALAEKEKDITEKSFNLDEKEK 462 >At5g63150.1 68418.m07929 expressed protein Length = 138 Score = 25.4 bits (53), Expect = 5.2 Identities = 13/41 (31%), Positives = 20/41 (48%) Frame = +2 Query: 122 LDVRRTTKKRENKKDDLTREMKVDAEKKRRKKTANVEDRRQ 244 LD+ T E ++D + D+ KK+RKK N R+ Sbjct: 89 LDLAETASLEEEEEDTKEIVIYADSVKKKRKKKMNKHKYRK 129 >At5g19300.1 68418.m02300 expressed protein contains Pfam profile PF02598: Uncharacterized ACR, COG2106 Length = 398 Score = 25.4 bits (53), Expect = 5.2 Identities = 11/33 (33%), Positives = 19/33 (57%) Frame = +2 Query: 143 KKRENKKDDLTREMKVDAEKKRRKKTANVEDRR 241 KKR+NK + E+ + K + ++ NVE+ R Sbjct: 65 KKRKNKNQEEEPELVTEKTKVQEEEKGNVEEGR 97 >At4g26630.1 68417.m03837 expressed protein Length = 763 Score = 25.4 bits (53), Expect = 5.2 Identities = 12/25 (48%), Positives = 16/25 (64%) Frame = +1 Query: 145 KEGEQER*FNEGNESRRRKETEKED 219 KEG ++ NE ES+ KE EKE+ Sbjct: 244 KEGSEDENDNEKVESKDAKEDEKEE 268 >At1g71160.1 68414.m08211 beta-ketoacyl-CoA synthase family protein similar to fatty acid elongase 3-ketoacyl-CoA synthase 1 GB:AAC99312, very-long-chain fatty acid condensing enzyme CUT1 [GI:5001734] Length = 460 Score = 25.4 bits (53), Expect = 5.2 Identities = 17/43 (39%), Positives = 23/43 (53%) Frame = -3 Query: 235 VFNICSLLSPFLFGVYFHFPR*IIFLVLPLFSCSSHVQFSGFP 107 V + C L++ +FG YF PR II+L+ FSC F P Sbjct: 26 VASACVLIA--VFGYYFFKPRCIIYLI--DFSCYQPPDFLRAP 64 >At4g22730.1 68417.m03279 leucine-rich repeat transmembrane protein kinase, putative leucine rich repeat receptor-like kinase, Oryza sativa, PATCHX:E267533 Length = 688 Score = 25.0 bits (52), Expect = 6.9 Identities = 10/14 (71%), Positives = 12/14 (85%) Frame = +1 Query: 79 SIDQKIPKNVGSLK 120 S+ KIPKN+GSLK Sbjct: 151 SLTGKIPKNIGSLK 164 >At3g20550.1 68416.m02601 forkhead-associated domain-containing protein / FHA domain-containing protein weak similarity to SP|Q28147 Nuclear inhibitor of protein phosphatase-1 (NIPP-1) (Protein phosphatase 1, regulatory inhibitor subunit 8) {Bos taurus}; contains Pfam profile PF00498: FHA domain Length = 314 Score = 25.0 bits (52), Expect = 6.9 Identities = 13/32 (40%), Positives = 22/32 (68%), Gaps = 2/32 (6%) Frame = +1 Query: 124 GREKNN*KEGEQER*FNEGNESRR--RKETEK 213 GR+++ ++GE ER G++ RR R++TEK Sbjct: 50 GRDRDRERKGEGERDREVGDKRRRSGREDTEK 81 >At3g12640.1 68416.m01573 RNA recognition motif (RRM)-containing protein contains InterPro entry IPR000504: RNA-binding region RNP-1 (RNA recognition motif) (RRM) Length = 674 Score = 25.0 bits (52), Expect = 6.9 Identities = 15/42 (35%), Positives = 23/42 (54%) Frame = +3 Query: 33 KTNKES*DDNRRKLN*Y*SKDTKKRGKPENWT*EEQLKRGRT 158 +TNKE+ D R+L + +D +P N + E LKR R+ Sbjct: 206 ETNKEAKPDVSRRLLQFAVRDALAISRPANSSTESSLKRLRS 247 >At2g34880.1 68415.m04282 transcription factor jumonji (jmj) family protein / zinc finger (C5HC2 type) family protein contains Pfam domains, PF02375: jmjN domain, PF02373: jmjC domain and PF02928: C5HC2 zinc finger Length = 806 Score = 25.0 bits (52), Expect = 6.9 Identities = 12/35 (34%), Positives = 17/35 (48%) Frame = +2 Query: 98 QKTWEA*KLDVRRTTKKRENKKDDLTREMKVDAEK 202 QK WE L V+ +R N+K D+ +D K Sbjct: 712 QKCWEMVLLRVKEEIMRRSNQKQDVHMLESIDGLK 746 >At2g28290.2 68415.m03434 chromatin remodeling protein, putative (SYD) similar to transcriptional activator HBRM [Homo sapiens] GI:414117; contains Pfam profiles PF00271: Helicase conserved C-terminal domain, PF00176: SNF2 family N-terminal domain; identical to cDNA putative chromatin remodeling protein SYD (SPLAYED) GI:13603720 Length = 3529 Score = 25.0 bits (52), Expect = 6.9 Identities = 15/35 (42%), Positives = 19/35 (54%) Frame = +3 Query: 153 RTRKMI*RGK*K*TPKRNGERRLQMLKTEDSDRRR 257 R R + RG+ TPKR G+RR Q L D+ R Sbjct: 1770 RVRNLPSRGE---TPKRQGKRRGQPLPATDASSAR 1801 >At2g28290.1 68415.m03433 chromatin remodeling protein, putative (SYD) similar to transcriptional activator HBRM [Homo sapiens] GI:414117; contains Pfam profiles PF00271: Helicase conserved C-terminal domain, PF00176: SNF2 family N-terminal domain; identical to cDNA putative chromatin remodeling protein SYD (SPLAYED) GI:13603720 Length = 3574 Score = 25.0 bits (52), Expect = 6.9 Identities = 15/35 (42%), Positives = 19/35 (54%) Frame = +3 Query: 153 RTRKMI*RGK*K*TPKRNGERRLQMLKTEDSDRRR 257 R R + RG+ TPKR G+RR Q L D+ R Sbjct: 1770 RVRNLPSRGE---TPKRQGKRRGQPLPATDASSAR 1801 >At1g80930.1 68414.m09495 MIF4G domain-containing protein / MA3 domain-containing protein similar to SP|Q9P6R9 Cell cycle control protein cwf22 {Schizosaccharomyces pombe}; contains Pfam profiles PF02854: MIF4G domain, PF02847: MA3 domain Length = 900 Score = 25.0 bits (52), Expect = 6.9 Identities = 11/38 (28%), Positives = 20/38 (52%) Frame = +2 Query: 128 VRRTTKKRENKKDDLTREMKVDAEKKRRKKTANVEDRR 241 VRR ++R + D+ R + RR + ++ EDR+ Sbjct: 14 VRRRDRRRRERSPDVRRSRTETDDVARRVRVSDDEDRK 51 >At1g68880.1 68414.m07883 bZIP transcription factor family protein similar to common plant regulatory factor 6 GI:9650826 from [Petroselinum crispum]; contains Pfam profile: PF00170 bZIP transcription factor Length = 138 Score = 25.0 bits (52), Expect = 6.9 Identities = 15/32 (46%), Positives = 20/32 (62%), Gaps = 1/32 (3%) Frame = +2 Query: 164 DDLTREMKVDAEKKRRKKTANVED-RRQRSPK 256 DD +R + D E+KRR+K +N E RR R K Sbjct: 36 DDSSRTAE-DNERKRRRKVSNRESARRSRMRK 66 >At5g65900.1 68418.m08295 DEAD/DEAH box helicase, putative contains Pfam profiles PF00270:DEAD/DEAH box helicase and PF00271: Helicase conserved C-terminal domain; identical to cDNA RH27 helicase, partial GI:4033334 Length = 633 Score = 24.6 bits (51), Expect = 9.1 Identities = 15/67 (22%), Positives = 32/67 (47%), Gaps = 2/67 (2%) Frame = +1 Query: 25 RKKKLIRNHKM--TTDGNLISIDQKIPKNVGSLKTGREKNN*KEGEQER*FNEGNESRRR 198 +KKK +N K T DG ++ ++ PK ++ E++ E E +++ Sbjct: 60 KKKKKKKNKKRGDTDDGEDEAVAEEEPKKKKKKNKKLQQRGDTNDEEDEVIAEEEEPKKK 119 Query: 199 KETEKED 219 K+ +++D Sbjct: 120 KKKQRKD 126 >At5g54030.1 68418.m06720 DC1 domain-containing protein contains Pfam profile PF03107: DC1 domain Length = 419 Score = 24.6 bits (51), Expect = 9.1 Identities = 9/21 (42%), Positives = 14/21 (66%) Frame = +1 Query: 25 RKKKLIRNHKMTTDGNLISID 87 +K+ L+ NHK+T LI+ D Sbjct: 332 KKRHLLHNHKLTLSSTLINKD 352 >At5g41020.1 68418.m04986 myb family transcription factor contains Pfam profile: PF00249 Myb DNA binding domain Length = 588 Score = 24.6 bits (51), Expect = 9.1 Identities = 11/44 (25%), Positives = 27/44 (61%), Gaps = 2/44 (4%) Frame = +2 Query: 131 RRTTKKRENKKDDL--TREMKVDAEKKRRKKTANVEDRRQRSPK 256 ++ ++ E +++ L T++ K +KK++KK + V + ++S K Sbjct: 217 KKQSEDSETEENGLNSTKDAKKRRKKKKKKKQSEVSEAEEKSDK 260 >At5g23750.2 68418.m02787 remorin family protein contains Pfam domain, PF03766: Remorin, N-terminal region; contains Pfam domain, PF03763: Remorin, C-terminal region Length = 201 Score = 24.6 bits (51), Expect = 9.1 Identities = 24/89 (26%), Positives = 41/89 (46%), Gaps = 8/89 (8%) Frame = +2 Query: 5 EDKKHNFVRKN**GIIR*QQTET*LVLIKRYQKTWEA*KLDVRRTTKKR--------ENK 160 E+KK V ++ ++ +TE + LIK ++ EA K V +K+ NK Sbjct: 71 EEKKEGSVNRD--AVLARVETEKRMSLIKAWE---EAEKCKVENKAEKKLSSIGSWENNK 125 Query: 161 KDDLTREMKVDAEKKRRKKTANVEDRRQR 247 K + E+K E+ +KK VE + + Sbjct: 126 KAAVEAELKKMEEQLEKKKAEYVEQMKNK 154 >At5g23750.1 68418.m02786 remorin family protein contains Pfam domain, PF03766: Remorin, N-terminal region; contains Pfam domain, PF03763: Remorin, C-terminal region Length = 202 Score = 24.6 bits (51), Expect = 9.1 Identities = 24/89 (26%), Positives = 41/89 (46%), Gaps = 8/89 (8%) Frame = +2 Query: 5 EDKKHNFVRKN**GIIR*QQTET*LVLIKRYQKTWEA*KLDVRRTTKKR--------ENK 160 E+KK V ++ ++ +TE + LIK ++ EA K V +K+ NK Sbjct: 72 EEKKEGSVNRD--AVLARVETEKRMSLIKAWE---EAEKCKVENKAEKKLSSIGSWENNK 126 Query: 161 KDDLTREMKVDAEKKRRKKTANVEDRRQR 247 K + E+K E+ +KK VE + + Sbjct: 127 KAAVEAELKKMEEQLEKKKAEYVEQMKNK 155 >At3g51070.1 68416.m05592 dehydration-responsive protein-related similar to early-responsive to dehydration stress ERD3 protein [Arabidopsis thaliana] GI:15320410; contains Pfam profile PF03141: Putative methyltransferase Length = 895 Score = 24.6 bits (51), Expect = 9.1 Identities = 17/68 (25%), Positives = 31/68 (45%) Frame = +1 Query: 13 KTQFRKKKLIRNHKMTTDGNLISIDQKIPKNVGSLKTGREKNN*KEGEQER*FNEGNESR 192 K++ ++K + TT + + + N + +EK+N KE + + EG + Sbjct: 100 KSEDEQRKSAKEKSETTSSKTQTQETQ-QNNDDKISEEKEKDNGKENQTVQESEEGQMKK 158 Query: 193 RRKETEKE 216 KE EKE Sbjct: 159 VVKEFEKE 166 >At1g19390.1 68414.m02412 wall-associated kinase, putative similar to GB:CAB42872 from [Arabidopsis thaliana] (Plant Mol. Biol. 39 (6), 1189-1196 (1999)) Length = 788 Score = 24.6 bits (51), Expect = 9.1 Identities = 10/21 (47%), Positives = 15/21 (71%) Frame = -1 Query: 69 SVCCHLMIPY*FFLTKLCFLS 7 SVC ++ IPY F + K C+L+ Sbjct: 36 SVCGNINIPYPFGIEKGCYLN 56 Database: arabidopsis Posted date: Oct 4, 2007 10:56 AM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 4,910,930 Number of Sequences: 28952 Number of extensions: 85638 Number of successful extensions: 533 Number of sequences better than 10.0: 57 Number of HSP's better than 10.0 without gapping: 440 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 520 length of database: 12,070,560 effective HSP length: 64 effective length of database: 10,217,632 effective search space used: 214570272 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -