BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= S06A01NCLL0001_M18 (526 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AB097127-1|BAC82595.1| 1209|Anopheles gambiae reverse transcript... 25 1.6 DQ383819-1|ABD38144.1| 377|Anopheles gambiae abdominal-B protein. 23 6.3 AB090815-1|BAC57905.1| 492|Anopheles gambiae gag-like protein p... 23 8.3 >AB097127-1|BAC82595.1| 1209|Anopheles gambiae reverse transcriptase protein. Length = 1209 Score = 25.0 bits (52), Expect = 1.6 Identities = 17/64 (26%), Positives = 30/64 (46%) Frame = +3 Query: 159 QALRQSCIHRLQTWSAQPT*KYSFVKD*RYKGSQ*CTFLCWQALRVCLPCKEKDADPRGS 338 QAL S IH+L+++ + ++ + YK + L L C K D +G+ Sbjct: 891 QALCISQIHQLRSYFVESQNRHELYRT-VYKADHGLSALHLAQQDYQLNCNIKTVDGKGA 949 Query: 339 TWQE 350 TW++ Sbjct: 950 TWKQ 953 >DQ383819-1|ABD38144.1| 377|Anopheles gambiae abdominal-B protein. Length = 377 Score = 23.0 bits (47), Expect = 6.3 Identities = 10/32 (31%), Positives = 14/32 (43%) Frame = +1 Query: 388 PHGNSGGVRARFKSNLPAQAMGHRIRVMLYPS 483 P GN + + P A+ I+ M YPS Sbjct: 149 PWGNDSAADYAYHAQYPPYALATDIKPMYYPS 180 >AB090815-1|BAC57905.1| 492|Anopheles gambiae gag-like protein protein. Length = 492 Score = 22.6 bits (46), Expect = 8.3 Identities = 8/26 (30%), Positives = 15/26 (57%) Frame = +1 Query: 406 GVRARFKSNLPAQAMGHRIRVMLYPS 483 G+ + SNLP + HR++ + P+ Sbjct: 445 GILPKHASNLPDVSFVHRVQTCIIPA 470 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 560,660 Number of Sequences: 2352 Number of extensions: 12729 Number of successful extensions: 34 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 30 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 34 length of database: 563,979 effective HSP length: 60 effective length of database: 422,859 effective search space used: 48205926 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -