BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= S06A01NCLL0001_M17 (353 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value DQ659253-1|ABG47451.1| 439|Tribolium castaneum imaginal disc gr... 21 3.7 AY884062-1|AAX84203.1| 712|Tribolium castaneum laccase 2B protein. 20 8.6 AY675073-1|AAV74190.1| 533|Tribolium castaneum chitinase 5 prot... 20 8.6 >DQ659253-1|ABG47451.1| 439|Tribolium castaneum imaginal disc growth factor 2 protein. Length = 439 Score = 21.0 bits (42), Expect = 3.7 Identities = 8/24 (33%), Positives = 15/24 (62%) Frame = -1 Query: 95 NVKFRAQMPRITRRSAYKHNVKTI 24 N+K+R + TRR A+ ++ T+ Sbjct: 119 NIKYRNLLETTTRRLAFVNSAYTL 142 >AY884062-1|AAX84203.1| 712|Tribolium castaneum laccase 2B protein. Length = 712 Score = 19.8 bits (39), Expect = 8.6 Identities = 8/17 (47%), Positives = 9/17 (52%) Frame = -1 Query: 296 FNLAPKKALMNVKNTNY 246 FNL P K + V N Y Sbjct: 638 FNLPPSKDTIAVPNNGY 654 >AY675073-1|AAV74190.1| 533|Tribolium castaneum chitinase 5 protein. Length = 533 Score = 19.8 bits (39), Expect = 8.6 Identities = 12/31 (38%), Positives = 13/31 (41%) Frame = -3 Query: 138 PLSATP*RAVSL*RECEISRSNASHYAKECL 46 P ATP R V I R YA+E L Sbjct: 16 PYDATPARIVCYFSNWAIYRPGIGRYAQEDL 46 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 74,284 Number of Sequences: 336 Number of extensions: 1412 Number of successful extensions: 3 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 3 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 3 length of database: 122,585 effective HSP length: 50 effective length of database: 105,785 effective search space used: 7087595 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 39 (20.8 bits)
- SilkBase 1999-2023 -