BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= S06A01NCLL0001_M17 (353 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_57424| Best HMM Match : Endonuclease_1 (HMM E-Value=6.1e-20) 28 2.5 SB_8185| Best HMM Match : Rho_N (HMM E-Value=0.0007) 27 4.4 SB_22755| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 5.8 SB_57894| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 5.8 SB_4407| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 5.8 SB_56938| Best HMM Match : No HMM Matches (HMM E-Value=.) 26 7.7 SB_50462| Best HMM Match : Rho_N (HMM E-Value=0.0007) 26 7.7 SB_43788| Best HMM Match : No HMM Matches (HMM E-Value=.) 26 7.7 SB_41355| Best HMM Match : Rho_N (HMM E-Value=0.0007) 26 7.7 SB_34735| Best HMM Match : NUDIX (HMM E-Value=6.1) 26 7.7 SB_33840| Best HMM Match : No HMM Matches (HMM E-Value=.) 26 7.7 SB_23283| Best HMM Match : Rho_N (HMM E-Value=0.0007) 26 7.7 SB_20968| Best HMM Match : Rho_N (HMM E-Value=0.0007) 26 7.7 SB_17943| Best HMM Match : NUDIX (HMM E-Value=6.9) 26 7.7 SB_17800| Best HMM Match : Endonuclease_7 (HMM E-Value=0.032) 26 7.7 SB_17153| Best HMM Match : Rho_N (HMM E-Value=0.0007) 26 7.7 SB_15820| Best HMM Match : No HMM Matches (HMM E-Value=.) 26 7.7 SB_15202| Best HMM Match : Rho_N (HMM E-Value=2.3e-05) 26 7.7 SB_11321| Best HMM Match : Endonuclease_7 (HMM E-Value=0.18) 26 7.7 SB_9405| Best HMM Match : DNA_pol_B_2 (HMM E-Value=0.00011) 26 7.7 SB_8141| Best HMM Match : Rho_N (HMM E-Value=0.011) 26 7.7 SB_7531| Best HMM Match : No HMM Matches (HMM E-Value=.) 26 7.7 SB_1355| Best HMM Match : No HMM Matches (HMM E-Value=.) 26 7.7 SB_6| Best HMM Match : Rho_N (HMM E-Value=0.0007) 26 7.7 SB_55600| Best HMM Match : No HMM Matches (HMM E-Value=.) 26 7.7 SB_52355| Best HMM Match : GnsAB (HMM E-Value=4.4) 26 7.7 SB_51281| Best HMM Match : No HMM Matches (HMM E-Value=.) 26 7.7 SB_47604| Best HMM Match : Toxin_23 (HMM E-Value=2.3) 26 7.7 SB_45728| Best HMM Match : NUDIX (HMM E-Value=6.7) 26 7.7 SB_43301| Best HMM Match : Rho_N (HMM E-Value=0.0007) 26 7.7 SB_42931| Best HMM Match : No HMM Matches (HMM E-Value=.) 26 7.7 SB_40351| Best HMM Match : NUDIX (HMM E-Value=9) 26 7.7 SB_35234| Best HMM Match : NUDIX (HMM E-Value=9) 26 7.7 SB_35049| Best HMM Match : No HMM Matches (HMM E-Value=.) 26 7.7 SB_31660| Best HMM Match : No HMM Matches (HMM E-Value=.) 26 7.7 SB_31577| Best HMM Match : Rho_N (HMM E-Value=0.0007) 26 7.7 SB_31523| Best HMM Match : Rho_N (HMM E-Value=0.0007) 26 7.7 SB_23247| Best HMM Match : Rho_N (HMM E-Value=0.0066) 26 7.7 SB_18569| Best HMM Match : Rho_N (HMM E-Value=0.0007) 26 7.7 SB_18280| Best HMM Match : Toxin_23 (HMM E-Value=2.3) 26 7.7 SB_9492| Best HMM Match : Rho_N (HMM E-Value=2.1e-12) 26 7.7 SB_6396| Best HMM Match : No HMM Matches (HMM E-Value=.) 26 7.7 SB_6190| Best HMM Match : NUDIX (HMM E-Value=7.3) 26 7.7 SB_3816| Best HMM Match : Rho_N (HMM E-Value=0.0007) 26 7.7 SB_1634| Best HMM Match : No HMM Matches (HMM E-Value=.) 26 7.7 >SB_57424| Best HMM Match : Endonuclease_1 (HMM E-Value=6.1e-20) Length = 360 Score = 27.9 bits (59), Expect = 2.5 Identities = 16/49 (32%), Positives = 20/49 (40%) Frame = -3 Query: 198 DLVLFFYKNNKHFFLIYSNTPLSATP*RAVSL*RECEISRSNASHYAKE 52 DL L++ +N IYS P A P + EC S Y KE Sbjct: 51 DLDLYYENDNSTILDIYSENPSGADPYNYTPVTNECGNYNSEGDCYNKE 99 >SB_8185| Best HMM Match : Rho_N (HMM E-Value=0.0007) Length = 1133 Score = 27.1 bits (57), Expect = 4.4 Identities = 12/19 (63%), Positives = 14/19 (73%) Frame = -1 Query: 299 LFNLAPKKALMNVKNTNYH 243 L LA KKA++NVKN N H Sbjct: 303 LSELASKKAIINVKNENDH 321 >SB_22755| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 145 Score = 26.6 bits (56), Expect = 5.8 Identities = 9/23 (39%), Positives = 18/23 (78%) Frame = -3 Query: 246 PPVRKATQLRRADKKIDLVLFFY 178 PP+R +T++R+A +++DL L + Sbjct: 91 PPLRHSTRIRKAPERLDLKLCLF 113 >SB_57894| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 253 Score = 26.6 bits (56), Expect = 5.8 Identities = 11/16 (68%), Positives = 13/16 (81%) Frame = -1 Query: 290 LAPKKALMNVKNTNYH 243 LA KKA++NVKN N H Sbjct: 14 LASKKAIINVKNENEH 29 >SB_4407| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 112 Score = 26.6 bits (56), Expect = 5.8 Identities = 9/23 (39%), Positives = 18/23 (78%) Frame = -3 Query: 246 PPVRKATQLRRADKKIDLVLFFY 178 PP+R +T++R+A +++DL L + Sbjct: 58 PPLRHSTRIRKAPERLDLKLCLF 80 >SB_56938| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 653 Score = 26.2 bits (55), Expect = 7.7 Identities = 11/16 (68%), Positives = 13/16 (81%) Frame = -1 Query: 290 LAPKKALMNVKNTNYH 243 LA KKA++NVKN N H Sbjct: 172 LASKKAIINVKNENDH 187 >SB_50462| Best HMM Match : Rho_N (HMM E-Value=0.0007) Length = 355 Score = 26.2 bits (55), Expect = 7.7 Identities = 11/16 (68%), Positives = 13/16 (81%) Frame = -1 Query: 290 LAPKKALMNVKNTNYH 243 LA KKA++NVKN N H Sbjct: 306 LASKKAIINVKNENDH 321 >SB_43788| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 174 Score = 26.2 bits (55), Expect = 7.7 Identities = 11/16 (68%), Positives = 13/16 (81%) Frame = -1 Query: 290 LAPKKALMNVKNTNYH 243 LA KKA++NVKN N H Sbjct: 49 LASKKAIINVKNENDH 64 >SB_41355| Best HMM Match : Rho_N (HMM E-Value=0.0007) Length = 992 Score = 26.2 bits (55), Expect = 7.7 Identities = 11/16 (68%), Positives = 13/16 (81%) Frame = -1 Query: 290 LAPKKALMNVKNTNYH 243 LA KKA++NVKN N H Sbjct: 306 LASKKAIINVKNENDH 321 >SB_34735| Best HMM Match : NUDIX (HMM E-Value=6.1) Length = 431 Score = 26.2 bits (55), Expect = 7.7 Identities = 11/16 (68%), Positives = 13/16 (81%) Frame = -1 Query: 290 LAPKKALMNVKNTNYH 243 LA KKA++NVKN N H Sbjct: 176 LASKKAIINVKNENDH 191 >SB_33840| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 357 Score = 26.2 bits (55), Expect = 7.7 Identities = 11/16 (68%), Positives = 13/16 (81%) Frame = -1 Query: 290 LAPKKALMNVKNTNYH 243 LA KKA++NVKN N H Sbjct: 306 LASKKAIINVKNENDH 321 >SB_23283| Best HMM Match : Rho_N (HMM E-Value=0.0007) Length = 1128 Score = 26.2 bits (55), Expect = 7.7 Identities = 11/16 (68%), Positives = 13/16 (81%) Frame = -1 Query: 290 LAPKKALMNVKNTNYH 243 LA KKA++NVKN N H Sbjct: 298 LASKKAIINVKNENDH 313 >SB_20968| Best HMM Match : Rho_N (HMM E-Value=0.0007) Length = 303 Score = 26.2 bits (55), Expect = 7.7 Identities = 11/16 (68%), Positives = 13/16 (81%) Frame = -1 Query: 290 LAPKKALMNVKNTNYH 243 LA KKA++NVKN N H Sbjct: 254 LASKKAIINVKNENDH 269 >SB_17943| Best HMM Match : NUDIX (HMM E-Value=6.9) Length = 282 Score = 26.2 bits (55), Expect = 7.7 Identities = 11/16 (68%), Positives = 13/16 (81%) Frame = -1 Query: 290 LAPKKALMNVKNTNYH 243 LA KKA++NVKN N H Sbjct: 123 LASKKAIINVKNENDH 138 >SB_17800| Best HMM Match : Endonuclease_7 (HMM E-Value=0.032) Length = 644 Score = 26.2 bits (55), Expect = 7.7 Identities = 11/16 (68%), Positives = 13/16 (81%) Frame = -1 Query: 290 LAPKKALMNVKNTNYH 243 LA KKA++NVKN N H Sbjct: 18 LASKKAIINVKNENDH 33 >SB_17153| Best HMM Match : Rho_N (HMM E-Value=0.0007) Length = 393 Score = 26.2 bits (55), Expect = 7.7 Identities = 11/16 (68%), Positives = 13/16 (81%) Frame = -1 Query: 290 LAPKKALMNVKNTNYH 243 LA KKA++NVKN N H Sbjct: 306 LASKKAIINVKNENDH 321 >SB_15820| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1998 Score = 26.2 bits (55), Expect = 7.7 Identities = 11/16 (68%), Positives = 13/16 (81%) Frame = -1 Query: 290 LAPKKALMNVKNTNYH 243 LA KKA++NVKN N H Sbjct: 381 LASKKAIINVKNENDH 396 >SB_15202| Best HMM Match : Rho_N (HMM E-Value=2.3e-05) Length = 416 Score = 26.2 bits (55), Expect = 7.7 Identities = 11/16 (68%), Positives = 13/16 (81%) Frame = -1 Query: 290 LAPKKALMNVKNTNYH 243 LA KKA++NVKN N H Sbjct: 299 LASKKAIINVKNENDH 314 >SB_11321| Best HMM Match : Endonuclease_7 (HMM E-Value=0.18) Length = 704 Score = 26.2 bits (55), Expect = 7.7 Identities = 11/16 (68%), Positives = 13/16 (81%) Frame = -1 Query: 290 LAPKKALMNVKNTNYH 243 LA KKA++NVKN N H Sbjct: 18 LASKKAIINVKNENDH 33 >SB_9405| Best HMM Match : DNA_pol_B_2 (HMM E-Value=0.00011) Length = 1092 Score = 26.2 bits (55), Expect = 7.7 Identities = 11/16 (68%), Positives = 13/16 (81%) Frame = -1 Query: 290 LAPKKALMNVKNTNYH 243 LA KKA++NVKN N H Sbjct: 299 LASKKAIINVKNENDH 314 >SB_8141| Best HMM Match : Rho_N (HMM E-Value=0.011) Length = 299 Score = 26.2 bits (55), Expect = 7.7 Identities = 11/16 (68%), Positives = 13/16 (81%) Frame = -1 Query: 290 LAPKKALMNVKNTNYH 243 LA KKA++NVKN N H Sbjct: 271 LASKKAIINVKNENDH 286 >SB_7531| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 393 Score = 26.2 bits (55), Expect = 7.7 Identities = 11/16 (68%), Positives = 13/16 (81%) Frame = -1 Query: 290 LAPKKALMNVKNTNYH 243 LA KKA++NVKN N H Sbjct: 306 LASKKAIINVKNENDH 321 >SB_1355| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 206 Score = 26.2 bits (55), Expect = 7.7 Identities = 11/16 (68%), Positives = 13/16 (81%) Frame = -1 Query: 290 LAPKKALMNVKNTNYH 243 LA KKA++NVKN N H Sbjct: 49 LASKKAIINVKNENDH 64 >SB_6| Best HMM Match : Rho_N (HMM E-Value=0.0007) Length = 486 Score = 26.2 bits (55), Expect = 7.7 Identities = 11/16 (68%), Positives = 13/16 (81%) Frame = -1 Query: 290 LAPKKALMNVKNTNYH 243 LA KKA++NVKN N H Sbjct: 215 LASKKAIINVKNENDH 230 >SB_55600| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 971 Score = 26.2 bits (55), Expect = 7.7 Identities = 11/16 (68%), Positives = 13/16 (81%) Frame = -1 Query: 290 LAPKKALMNVKNTNYH 243 LA KKA++NVKN N H Sbjct: 246 LASKKAIINVKNENDH 261 >SB_52355| Best HMM Match : GnsAB (HMM E-Value=4.4) Length = 384 Score = 26.2 bits (55), Expect = 7.7 Identities = 11/16 (68%), Positives = 13/16 (81%) Frame = -1 Query: 290 LAPKKALMNVKNTNYH 243 LA KKA++NVKN N H Sbjct: 248 LASKKAIINVKNENDH 263 >SB_51281| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 56 Score = 26.2 bits (55), Expect = 7.7 Identities = 12/39 (30%), Positives = 19/39 (48%) Frame = +3 Query: 141 YYCILKKNAYYFYKKKEPDRFSCRLFSTGLLFEPVVVSV 257 Y +K+ + K E RF+C +F + EPV S+ Sbjct: 17 YSTKIKRYFAFITKHPEEPRFACHVFMSEFSTEPVAYSI 55 >SB_47604| Best HMM Match : Toxin_23 (HMM E-Value=2.3) Length = 407 Score = 26.2 bits (55), Expect = 7.7 Identities = 11/16 (68%), Positives = 13/16 (81%) Frame = -1 Query: 290 LAPKKALMNVKNTNYH 243 LA KKA++NVKN N H Sbjct: 199 LASKKAIINVKNENDH 214 >SB_45728| Best HMM Match : NUDIX (HMM E-Value=6.7) Length = 283 Score = 26.2 bits (55), Expect = 7.7 Identities = 11/16 (68%), Positives = 13/16 (81%) Frame = -1 Query: 290 LAPKKALMNVKNTNYH 243 LA KKA++NVKN N H Sbjct: 126 LASKKAIINVKNENDH 141 >SB_43301| Best HMM Match : Rho_N (HMM E-Value=0.0007) Length = 393 Score = 26.2 bits (55), Expect = 7.7 Identities = 11/16 (68%), Positives = 13/16 (81%) Frame = -1 Query: 290 LAPKKALMNVKNTNYH 243 LA KKA++NVKN N H Sbjct: 306 LASKKAIINVKNENDH 321 >SB_42931| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 266 Score = 26.2 bits (55), Expect = 7.7 Identities = 11/16 (68%), Positives = 13/16 (81%) Frame = -1 Query: 290 LAPKKALMNVKNTNYH 243 LA KKA++NVKN N H Sbjct: 186 LASKKAIINVKNENDH 201 >SB_40351| Best HMM Match : NUDIX (HMM E-Value=9) Length = 284 Score = 26.2 bits (55), Expect = 7.7 Identities = 11/16 (68%), Positives = 13/16 (81%) Frame = -1 Query: 290 LAPKKALMNVKNTNYH 243 LA KKA++NVKN N H Sbjct: 126 LASKKAIINVKNENDH 141 >SB_35234| Best HMM Match : NUDIX (HMM E-Value=9) Length = 356 Score = 26.2 bits (55), Expect = 7.7 Identities = 11/16 (68%), Positives = 13/16 (81%) Frame = -1 Query: 290 LAPKKALMNVKNTNYH 243 LA KKA++NVKN N H Sbjct: 199 LASKKAIINVKNENDH 214 >SB_35049| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 272 Score = 26.2 bits (55), Expect = 7.7 Identities = 11/16 (68%), Positives = 13/16 (81%) Frame = -1 Query: 290 LAPKKALMNVKNTNYH 243 LA KKA++NVKN N H Sbjct: 253 LASKKAIINVKNENDH 268 >SB_31660| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1185 Score = 26.2 bits (55), Expect = 7.7 Identities = 11/16 (68%), Positives = 13/16 (81%) Frame = -1 Query: 290 LAPKKALMNVKNTNYH 243 LA KKA++NVKN N H Sbjct: 388 LASKKAIINVKNENDH 403 >SB_31577| Best HMM Match : Rho_N (HMM E-Value=0.0007) Length = 871 Score = 26.2 bits (55), Expect = 7.7 Identities = 11/16 (68%), Positives = 13/16 (81%) Frame = -1 Query: 290 LAPKKALMNVKNTNYH 243 LA KKA++NVKN N H Sbjct: 306 LASKKAIINVKNENDH 321 >SB_31523| Best HMM Match : Rho_N (HMM E-Value=0.0007) Length = 1104 Score = 26.2 bits (55), Expect = 7.7 Identities = 11/16 (68%), Positives = 13/16 (81%) Frame = -1 Query: 290 LAPKKALMNVKNTNYH 243 LA KKA++NVKN N H Sbjct: 306 LASKKAIINVKNENDH 321 >SB_23247| Best HMM Match : Rho_N (HMM E-Value=0.0066) Length = 835 Score = 26.2 bits (55), Expect = 7.7 Identities = 11/16 (68%), Positives = 13/16 (81%) Frame = -1 Query: 290 LAPKKALMNVKNTNYH 243 LA KKA++NVKN N H Sbjct: 300 LASKKAIINVKNENDH 315 >SB_18569| Best HMM Match : Rho_N (HMM E-Value=0.0007) Length = 708 Score = 26.2 bits (55), Expect = 7.7 Identities = 11/16 (68%), Positives = 13/16 (81%) Frame = -1 Query: 290 LAPKKALMNVKNTNYH 243 LA KKA++NVKN N H Sbjct: 299 LASKKAIINVKNENDH 314 >SB_18280| Best HMM Match : Toxin_23 (HMM E-Value=2.3) Length = 315 Score = 26.2 bits (55), Expect = 7.7 Identities = 11/16 (68%), Positives = 13/16 (81%) Frame = -1 Query: 290 LAPKKALMNVKNTNYH 243 LA KKA++NVKN N H Sbjct: 18 LASKKAIINVKNENDH 33 >SB_9492| Best HMM Match : Rho_N (HMM E-Value=2.1e-12) Length = 1970 Score = 26.2 bits (55), Expect = 7.7 Identities = 11/16 (68%), Positives = 13/16 (81%) Frame = -1 Query: 290 LAPKKALMNVKNTNYH 243 LA KKA++NVKN N H Sbjct: 430 LASKKAIINVKNENDH 445 >SB_6396| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 382 Score = 26.2 bits (55), Expect = 7.7 Identities = 14/30 (46%), Positives = 17/30 (56%) Frame = -1 Query: 329 TSNQSIKRESLFNLAPKKALMNVKNTNYHR 240 TS Q IKR +L AL +KNT+ HR Sbjct: 197 TSQQPIKRVIEIHLPEVNALFFMKNTSNHR 226 >SB_6190| Best HMM Match : NUDIX (HMM E-Value=7.3) Length = 234 Score = 26.2 bits (55), Expect = 7.7 Identities = 11/16 (68%), Positives = 13/16 (81%) Frame = -1 Query: 290 LAPKKALMNVKNTNYH 243 LA KKA++NVKN N H Sbjct: 199 LASKKAIINVKNENDH 214 >SB_3816| Best HMM Match : Rho_N (HMM E-Value=0.0007) Length = 632 Score = 26.2 bits (55), Expect = 7.7 Identities = 11/16 (68%), Positives = 13/16 (81%) Frame = -1 Query: 290 LAPKKALMNVKNTNYH 243 LA KKA++NVKN N H Sbjct: 299 LASKKAIINVKNENDH 314 >SB_1634| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 499 Score = 26.2 bits (55), Expect = 7.7 Identities = 11/16 (68%), Positives = 13/16 (81%) Frame = -1 Query: 290 LAPKKALMNVKNTNYH 243 LA KKA++NVKN N H Sbjct: 306 LASKKAIINVKNENDH 321 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 9,315,379 Number of Sequences: 59808 Number of extensions: 158195 Number of successful extensions: 339 Number of sequences better than 10.0: 45 Number of HSP's better than 10.0 without gapping: 325 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 339 length of database: 16,821,457 effective HSP length: 73 effective length of database: 12,455,473 effective search space used: 548040812 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -