BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= S06A01NCLL0001_M17 (353 letters) Database: human 237,096 sequences; 76,859,062 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value BC047574-1|AAH47574.1| 899|Homo sapiens WDFY4 protein protein. 29 3.1 AK074085-1|BAB84911.1| 1887|Homo sapiens FLJ00156 protein protein. 29 3.1 AB046827-1|BAB13433.1| 1270|Homo sapiens KIAA1607 protein protein. 29 3.1 >BC047574-1|AAH47574.1| 899|Homo sapiens WDFY4 protein protein. Length = 899 Score = 29.5 bits (63), Expect = 3.1 Identities = 14/43 (32%), Positives = 21/43 (48%) Frame = -3 Query: 270 YECQKH*LPPVRKATQLRRADKKIDLVLFFYKNNKHFFLIYSN 142 Y CQ H +R+ Q R + I L +FF+ F + Y+N Sbjct: 173 YSCQCHSYADMRELRQARFLLQDIALEIFFHNGYSKFLVFYNN 215 >AK074085-1|BAB84911.1| 1887|Homo sapiens FLJ00156 protein protein. Length = 1887 Score = 29.5 bits (63), Expect = 3.1 Identities = 14/43 (32%), Positives = 21/43 (48%) Frame = -3 Query: 270 YECQKH*LPPVRKATQLRRADKKIDLVLFFYKNNKHFFLIYSN 142 Y CQ H +R+ Q R + I L +FF+ F + Y+N Sbjct: 1169 YSCQCHSYADMRELRQARFLLQDIALEIFFHNGYSKFLVFYNN 1211 >AB046827-1|BAB13433.1| 1270|Homo sapiens KIAA1607 protein protein. Length = 1270 Score = 29.5 bits (63), Expect = 3.1 Identities = 14/43 (32%), Positives = 21/43 (48%) Frame = -3 Query: 270 YECQKH*LPPVRKATQLRRADKKIDLVLFFYKNNKHFFLIYSN 142 Y CQ H +R+ Q R + I L +FF+ F + Y+N Sbjct: 544 YSCQCHSYADMRELRQARFLLQDIALEIFFHNGYSKFLVFYNN 586 Database: human Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 76,859,062 Number of sequences in database: 237,096 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 42,577,202 Number of Sequences: 237096 Number of extensions: 715551 Number of successful extensions: 1029 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 1015 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1029 length of database: 76,859,062 effective HSP length: 81 effective length of database: 57,654,286 effective search space used: 2075554296 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -