BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= S06A01NCLL0001_M17 (353 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value AY331183-1|AAP94623.1| 953|Apis mellifera NMDA-type glutamate r... 22 2.5 AB264313-1|BAF43600.1| 900|Apis mellifera ecdysone-induced prot... 21 5.7 DQ325094-1|ABD14108.1| 175|Apis mellifera complementary sex det... 20 7.5 DQ325093-1|ABD14107.1| 175|Apis mellifera complementary sex det... 20 7.5 DQ325092-1|ABD14106.1| 175|Apis mellifera complementary sex det... 20 7.5 DQ325091-1|ABD14105.1| 175|Apis mellifera complementary sex det... 20 7.5 DQ325082-1|ABD14096.1| 179|Apis mellifera complementary sex det... 20 7.5 DQ325080-1|ABD14094.1| 184|Apis mellifera complementary sex det... 20 7.5 DQ325079-1|ABD14093.1| 184|Apis mellifera complementary sex det... 20 7.5 DQ325078-1|ABD14092.1| 184|Apis mellifera complementary sex det... 20 7.5 AY569717-1|AAS86670.1| 397|Apis mellifera complementary sex det... 20 7.5 AY569712-1|AAS86665.1| 408|Apis mellifera complementary sex det... 20 7.5 AY569704-1|AAS86657.1| 426|Apis mellifera complementary sex det... 20 7.5 AY569703-1|AAS86656.1| 396|Apis mellifera complementary sex det... 20 7.5 AY569701-1|AAS86654.1| 407|Apis mellifera complementary sex det... 20 7.5 AY569700-1|AAS86653.1| 407|Apis mellifera complementary sex det... 20 7.5 AY569699-1|AAS86652.1| 396|Apis mellifera complementary sex det... 20 7.5 AY569697-1|AAS86650.1| 413|Apis mellifera complementary sex det... 20 7.5 AY352277-1|AAQ67418.1| 418|Apis mellifera complementary sex det... 20 7.5 AY350617-1|AAQ57659.1| 428|Apis mellifera complementary sex det... 20 7.5 AY350615-1|AAQ57657.1| 410|Apis mellifera complementary sex det... 20 7.5 AF393493-1|AAL60418.1| 142|Apis mellifera odorant binding prote... 20 7.5 AF166497-1|AAD51945.1| 142|Apis mellifera putative odorant-bind... 20 7.5 >AY331183-1|AAP94623.1| 953|Apis mellifera NMDA-type glutamate receptor 1 protein. Length = 953 Score = 21.8 bits (44), Expect = 2.5 Identities = 8/27 (29%), Positives = 14/27 (51%) Frame = +2 Query: 2 HEDGKIHLLSLHYVYKHSFA*CEAFER 82 HE G + L H++ + + CE E+ Sbjct: 787 HESGFMESLDNHWILRSNVQQCEQLEK 813 >AB264313-1|BAF43600.1| 900|Apis mellifera ecdysone-induced protein 75 protein. Length = 900 Score = 20.6 bits (41), Expect = 5.7 Identities = 10/32 (31%), Positives = 16/32 (50%) Frame = +3 Query: 33 YIMFISTPSRNARHLSAKFHIRVIVKPRVTGS 128 Y+M ++P+ + R+LSA PR S Sbjct: 816 YLMVGNSPASSPRYLSAAATSSTSTSPRPASS 847 >DQ325094-1|ABD14108.1| 175|Apis mellifera complementary sex determiner protein. Length = 175 Score = 20.2 bits (40), Expect = 7.5 Identities = 9/22 (40%), Positives = 10/22 (45%) Frame = -1 Query: 149 TVIPRLARPRNARFHYNANVKF 84 T PR P RFH N +F Sbjct: 149 TPFPRFIPPNAYRFHPPLNPRF 170 >DQ325093-1|ABD14107.1| 175|Apis mellifera complementary sex determiner protein. Length = 175 Score = 20.2 bits (40), Expect = 7.5 Identities = 9/22 (40%), Positives = 10/22 (45%) Frame = -1 Query: 149 TVIPRLARPRNARFHYNANVKF 84 T PR P RFH N +F Sbjct: 149 TPFPRFIPPNAYRFHPPLNPRF 170 >DQ325092-1|ABD14106.1| 175|Apis mellifera complementary sex determiner protein. Length = 175 Score = 20.2 bits (40), Expect = 7.5 Identities = 9/22 (40%), Positives = 10/22 (45%) Frame = -1 Query: 149 TVIPRLARPRNARFHYNANVKF 84 T PR P RFH N +F Sbjct: 149 TPFPRFIPPNAYRFHPPLNPRF 170 >DQ325091-1|ABD14105.1| 175|Apis mellifera complementary sex determiner protein. Length = 175 Score = 20.2 bits (40), Expect = 7.5 Identities = 9/22 (40%), Positives = 10/22 (45%) Frame = -1 Query: 149 TVIPRLARPRNARFHYNANVKF 84 T PR P RFH N +F Sbjct: 149 TPFPRFIPPNAYRFHPPLNPRF 170 >DQ325082-1|ABD14096.1| 179|Apis mellifera complementary sex determiner protein. Length = 179 Score = 20.2 bits (40), Expect = 7.5 Identities = 9/22 (40%), Positives = 10/22 (45%) Frame = -1 Query: 149 TVIPRLARPRNARFHYNANVKF 84 T PR P RFH N +F Sbjct: 153 TPFPRFIPPNAYRFHPPLNPRF 174 >DQ325080-1|ABD14094.1| 184|Apis mellifera complementary sex determiner protein. Length = 184 Score = 20.2 bits (40), Expect = 7.5 Identities = 9/22 (40%), Positives = 10/22 (45%) Frame = -1 Query: 149 TVIPRLARPRNARFHYNANVKF 84 T PR P RFH N +F Sbjct: 158 TPFPRFIPPNAYRFHPPLNPRF 179 >DQ325079-1|ABD14093.1| 184|Apis mellifera complementary sex determiner protein. Length = 184 Score = 20.2 bits (40), Expect = 7.5 Identities = 9/22 (40%), Positives = 10/22 (45%) Frame = -1 Query: 149 TVIPRLARPRNARFHYNANVKF 84 T PR P RFH N +F Sbjct: 158 TPFPRFIPPNAYRFHPPLNPRF 179 >DQ325078-1|ABD14092.1| 184|Apis mellifera complementary sex determiner protein. Length = 184 Score = 20.2 bits (40), Expect = 7.5 Identities = 9/22 (40%), Positives = 10/22 (45%) Frame = -1 Query: 149 TVIPRLARPRNARFHYNANVKF 84 T PR P RFH N +F Sbjct: 158 TPFPRFIPPNAYRFHPPLNPRF 179 >AY569717-1|AAS86670.1| 397|Apis mellifera complementary sex determiner protein. Length = 397 Score = 20.2 bits (40), Expect = 7.5 Identities = 9/14 (64%), Positives = 9/14 (64%) Frame = -3 Query: 234 KATQLRRADKKIDL 193 K QLR D KIDL Sbjct: 14 KFKQLRNEDNKIDL 27 >AY569712-1|AAS86665.1| 408|Apis mellifera complementary sex determiner protein. Length = 408 Score = 20.2 bits (40), Expect = 7.5 Identities = 9/14 (64%), Positives = 9/14 (64%) Frame = -3 Query: 234 KATQLRRADKKIDL 193 K QLR D KIDL Sbjct: 14 KFKQLRNEDNKIDL 27 >AY569704-1|AAS86657.1| 426|Apis mellifera complementary sex determiner protein. Length = 426 Score = 20.2 bits (40), Expect = 7.5 Identities = 9/14 (64%), Positives = 9/14 (64%) Frame = -3 Query: 234 KATQLRRADKKIDL 193 K QLR D KIDL Sbjct: 14 KFKQLRNEDNKIDL 27 >AY569703-1|AAS86656.1| 396|Apis mellifera complementary sex determiner protein. Length = 396 Score = 20.2 bits (40), Expect = 7.5 Identities = 9/14 (64%), Positives = 9/14 (64%) Frame = -3 Query: 234 KATQLRRADKKIDL 193 K QLR D KIDL Sbjct: 14 KFKQLRNEDNKIDL 27 >AY569701-1|AAS86654.1| 407|Apis mellifera complementary sex determiner protein. Length = 407 Score = 20.2 bits (40), Expect = 7.5 Identities = 9/14 (64%), Positives = 9/14 (64%) Frame = -3 Query: 234 KATQLRRADKKIDL 193 K QLR D KIDL Sbjct: 14 KFKQLRNEDNKIDL 27 >AY569700-1|AAS86653.1| 407|Apis mellifera complementary sex determiner protein. Length = 407 Score = 20.2 bits (40), Expect = 7.5 Identities = 9/14 (64%), Positives = 9/14 (64%) Frame = -3 Query: 234 KATQLRRADKKIDL 193 K QLR D KIDL Sbjct: 14 KFKQLRNEDNKIDL 27 >AY569699-1|AAS86652.1| 396|Apis mellifera complementary sex determiner protein. Length = 396 Score = 20.2 bits (40), Expect = 7.5 Identities = 9/14 (64%), Positives = 9/14 (64%) Frame = -3 Query: 234 KATQLRRADKKIDL 193 K QLR D KIDL Sbjct: 14 KFKQLRNEDNKIDL 27 >AY569697-1|AAS86650.1| 413|Apis mellifera complementary sex determiner protein. Length = 413 Score = 20.2 bits (40), Expect = 7.5 Identities = 9/14 (64%), Positives = 9/14 (64%) Frame = -3 Query: 234 KATQLRRADKKIDL 193 K QLR D KIDL Sbjct: 14 KFKQLRNEDSKIDL 27 >AY352277-1|AAQ67418.1| 418|Apis mellifera complementary sex determiner protein. Length = 418 Score = 20.2 bits (40), Expect = 7.5 Identities = 9/14 (64%), Positives = 9/14 (64%) Frame = -3 Query: 234 KATQLRRADKKIDL 193 K QLR D KIDL Sbjct: 14 KFKQLRNEDNKIDL 27 >AY350617-1|AAQ57659.1| 428|Apis mellifera complementary sex determiner protein. Length = 428 Score = 20.2 bits (40), Expect = 7.5 Identities = 9/14 (64%), Positives = 9/14 (64%) Frame = -3 Query: 234 KATQLRRADKKIDL 193 K QLR D KIDL Sbjct: 14 KFKQLRNEDNKIDL 27 >AY350615-1|AAQ57657.1| 410|Apis mellifera complementary sex determiner protein. Length = 410 Score = 20.2 bits (40), Expect = 7.5 Identities = 9/14 (64%), Positives = 9/14 (64%) Frame = -3 Query: 234 KATQLRRADKKIDL 193 K QLR D KIDL Sbjct: 14 KFKQLRNEDNKIDL 27 >AF393493-1|AAL60418.1| 142|Apis mellifera odorant binding protein ASP2 protein. Length = 142 Score = 20.2 bits (40), Expect = 7.5 Identities = 11/20 (55%), Positives = 13/20 (65%) Frame = +1 Query: 16 NTSIVFTLCL*ALLRVMRGI 75 NT + T CL A L V+RGI Sbjct: 2 NTLVTVT-CLLAALTVVRGI 20 >AF166497-1|AAD51945.1| 142|Apis mellifera putative odorant-binding protein ASP2 protein. Length = 142 Score = 20.2 bits (40), Expect = 7.5 Identities = 11/20 (55%), Positives = 13/20 (65%) Frame = +1 Query: 16 NTSIVFTLCL*ALLRVMRGI 75 NT + T CL A L V+RGI Sbjct: 2 NTLVTVT-CLLAALTVVRGI 20 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 89,551 Number of Sequences: 438 Number of extensions: 1979 Number of successful extensions: 23 Number of sequences better than 10.0: 23 Number of HSP's better than 10.0 without gapping: 23 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 23 length of database: 146,343 effective HSP length: 51 effective length of database: 124,005 effective search space used: 8184330 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 39 (20.8 bits)
- SilkBase 1999-2023 -