BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= S06A01NCLL0001_M15 (311 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value U50472-1|AAA93475.1| 141|Anopheles gambiae protein ( Anopheles ... 91 1e-20 CR954256-7|CAJ14148.1| 1087|Anopheles gambiae predicted protein ... 25 0.66 AY341159-1|AAR13723.1| 159|Anopheles gambiae CED6 protein. 24 1.5 AY341158-1|AAR13722.1| 159|Anopheles gambiae CED6 protein. 24 1.5 AY341157-1|AAR13721.1| 159|Anopheles gambiae CED6 protein. 24 1.5 DQ974173-1|ABJ52813.1| 553|Anopheles gambiae serpin 16 protein. 23 2.0 AY341161-1|AAR13725.1| 159|Anopheles gambiae CED6 protein. 22 4.6 AJ439353-6|CAD27928.1| 695|Anopheles gambiae putative G-protein... 22 4.6 AF281078-2|AAF82132.1| 755|Anopheles gambiae vitellogenin 2 pro... 22 4.6 AF281078-1|AAF82131.1| 2051|Anopheles gambiae vitellogenin 1 pro... 22 4.6 AY825878-1|AAV70441.1| 161|Anopheles gambiae voltage gated sodi... 22 6.1 AY825877-1|AAV70440.1| 161|Anopheles gambiae voltage gated sodi... 22 6.1 AY825874-1|AAV70437.1| 162|Anopheles gambiae voltage gated sodi... 22 6.1 AY825873-1|AAV70436.1| 162|Anopheles gambiae voltage gated sodi... 22 6.1 AY825872-1|AAV70435.1| 162|Anopheles gambiae voltage gated sodi... 22 6.1 AY825871-1|AAV70434.1| 162|Anopheles gambiae voltage gated sodi... 22 6.1 AY825870-1|AAV70433.1| 161|Anopheles gambiae voltage gated sodi... 22 6.1 AY825869-1|AAV70432.1| 161|Anopheles gambiae voltage gated sodi... 22 6.1 AY825868-1|AAV70431.1| 161|Anopheles gambiae voltage gated sodi... 22 6.1 AY825867-1|AAV70430.1| 161|Anopheles gambiae voltage gated sodi... 22 6.1 AY825866-1|AAV70429.1| 161|Anopheles gambiae voltage gated sodi... 22 6.1 AY825865-1|AAV70428.1| 161|Anopheles gambiae voltage gated sodi... 22 6.1 AY825862-1|AAV70425.1| 162|Anopheles gambiae voltage gated sodi... 22 6.1 AY825861-1|AAV70424.1| 162|Anopheles gambiae voltage gated sodi... 22 6.1 AY825860-1|AAV70423.1| 161|Anopheles gambiae voltage gated sodi... 22 6.1 AY825859-1|AAV70422.1| 161|Anopheles gambiae voltage gated sodi... 22 6.1 AY825856-1|AAV70419.1| 166|Anopheles gambiae voltage gated sodi... 22 6.1 AY825855-1|AAV70418.1| 166|Anopheles gambiae voltage gated sodi... 22 6.1 AY825854-1|AAV70417.1| 161|Anopheles gambiae voltage gated sodi... 22 6.1 AY825853-1|AAV70416.1| 161|Anopheles gambiae voltage gated sodi... 22 6.1 AY825852-1|AAV70415.1| 161|Anopheles gambiae voltage gated sodi... 22 6.1 AY825851-1|AAV70414.1| 161|Anopheles gambiae voltage gated sodi... 22 6.1 AY825850-1|AAV70413.1| 161|Anopheles gambiae voltage gated sodi... 22 6.1 AY825849-1|AAV70412.1| 161|Anopheles gambiae voltage gated sodi... 22 6.1 AY825848-1|AAV70411.1| 160|Anopheles gambiae voltage gated sodi... 22 6.1 AY825847-1|AAV70410.1| 160|Anopheles gambiae voltage gated sodi... 22 6.1 AY825846-1|AAV70409.1| 161|Anopheles gambiae voltage gated sodi... 22 6.1 AY825845-1|AAV70408.1| 161|Anopheles gambiae voltage gated sodi... 22 6.1 AY825844-1|AAV70407.1| 161|Anopheles gambiae voltage gated sodi... 22 6.1 AY825843-1|AAV70406.1| 161|Anopheles gambiae voltage gated sodi... 22 6.1 AY825842-1|AAV70405.1| 160|Anopheles gambiae voltage gated sodi... 22 6.1 AY825841-1|AAV70404.1| 160|Anopheles gambiae voltage gated sodi... 22 6.1 AY825840-1|AAV70403.1| 161|Anopheles gambiae voltage gated sodi... 22 6.1 AY825839-1|AAV70402.1| 161|Anopheles gambiae voltage gated sodi... 22 6.1 AY825838-1|AAV70401.1| 162|Anopheles gambiae voltage gated sodi... 22 6.1 AY825837-1|AAV70400.1| 162|Anopheles gambiae voltage gated sodi... 22 6.1 AY825836-1|AAV70399.1| 161|Anopheles gambiae voltage gated sodi... 22 6.1 AY825835-1|AAV70398.1| 161|Anopheles gambiae voltage gated sodi... 22 6.1 AY825834-1|AAV70397.1| 161|Anopheles gambiae voltage gated sodi... 22 6.1 AY825833-1|AAV70396.1| 161|Anopheles gambiae voltage gated sodi... 22 6.1 AM422833-1|CAM12801.1| 2139|Anopheles gambiae voltage-gated sodi... 22 6.1 EF426168-1|ABO26411.1| 155|Anopheles gambiae unknown protein. 21 8.1 AY341205-1|AAR13769.1| 285|Anopheles gambiae period protein. 21 8.1 AY341204-1|AAR13768.1| 285|Anopheles gambiae period protein. 21 8.1 AY341203-1|AAR13767.1| 285|Anopheles gambiae period protein. 21 8.1 AY341202-1|AAR13766.1| 285|Anopheles gambiae period protein. 21 8.1 AY341160-1|AAR13724.1| 159|Anopheles gambiae CED6 protein. 21 8.1 >U50472-1|AAA93475.1| 141|Anopheles gambiae protein ( Anopheles gambiae putativefatty acid binding protein mRNA, partial cds. ). Length = 141 Score = 90.6 bits (215), Expect = 1e-20 Identities = 45/81 (55%), Positives = 53/81 (65%) Frame = +1 Query: 67 GKKYKMTTSENFDDFMKALGVGLITRKAANAVTPTVELRKEGDEYNFVTSSTFKTTEMKF 246 GKKYKM SE FDD+M ALGVG++ RK N+++PTVEL K GDEY F T S +T Sbjct: 35 GKKYKMEKSEGFDDYMLALGVGMVLRKLGNSISPTVELVKNGDEYTFNTLSPSRTRRSSS 94 Query: 247 KPGEEFEEERADGVKVKSV*T 309 EF+EE DG VKSV T Sbjct: 95 SWAMEFDEETVDGRMVKSVCT 115 >CR954256-7|CAJ14148.1| 1087|Anopheles gambiae predicted protein protein. Length = 1087 Score = 25.0 bits (52), Expect = 0.66 Identities = 11/19 (57%), Positives = 11/19 (57%) Frame = +1 Query: 175 ELRKEGDEYNFVTSSTFKT 231 E R E D YNFVT F T Sbjct: 471 EQRLEADRYNFVTECFFMT 489 >AY341159-1|AAR13723.1| 159|Anopheles gambiae CED6 protein. Length = 159 Score = 23.8 bits (49), Expect = 1.5 Identities = 10/26 (38%), Positives = 13/26 (50%) Frame = +1 Query: 145 KAANAVTPTVELRKEGDEYNFVTSST 222 K VTPT + GD+ N +ST Sbjct: 89 KTGTGVTPTSSIASSGDDTNSSNNST 114 >AY341158-1|AAR13722.1| 159|Anopheles gambiae CED6 protein. Length = 159 Score = 23.8 bits (49), Expect = 1.5 Identities = 10/26 (38%), Positives = 13/26 (50%) Frame = +1 Query: 145 KAANAVTPTVELRKEGDEYNFVTSST 222 K VTPT + GD+ N +ST Sbjct: 89 KTGTGVTPTSSIASSGDDTNSSNNST 114 >AY341157-1|AAR13721.1| 159|Anopheles gambiae CED6 protein. Length = 159 Score = 23.8 bits (49), Expect = 1.5 Identities = 10/26 (38%), Positives = 13/26 (50%) Frame = +1 Query: 145 KAANAVTPTVELRKEGDEYNFVTSST 222 K VTPT + GD+ N +ST Sbjct: 89 KTGTGVTPTSSIASSGDDTNSSNNST 114 >DQ974173-1|ABJ52813.1| 553|Anopheles gambiae serpin 16 protein. Length = 553 Score = 23.4 bits (48), Expect = 2.0 Identities = 13/38 (34%), Positives = 18/38 (47%) Frame = -3 Query: 249 LELHLRGLECRRGDEIVFVTFLAQLHGWGHSISRLAGD 136 L L L G E + DE++ V Q H+I +L D Sbjct: 109 LSLMLLGAEAKTKDELIQVLGFEQYRNHLHNIHQLYSD 146 >AY341161-1|AAR13725.1| 159|Anopheles gambiae CED6 protein. Length = 159 Score = 22.2 bits (45), Expect = 4.6 Identities = 9/26 (34%), Positives = 12/26 (46%) Frame = +1 Query: 145 KAANAVTPTVELRKEGDEYNFVTSST 222 K TPT + GD+ N +ST Sbjct: 89 KTGTGATPTSSIASSGDDTNSSNNST 114 >AJ439353-6|CAD27928.1| 695|Anopheles gambiae putative G-protein coupled receptor protein. Length = 695 Score = 22.2 bits (45), Expect = 4.6 Identities = 10/15 (66%), Positives = 11/15 (73%) Frame = -1 Query: 218 EEVTKLYSSPSLRSS 174 E V K+YSS SLR S Sbjct: 128 ENVIKVYSSKSLRKS 142 >AF281078-2|AAF82132.1| 755|Anopheles gambiae vitellogenin 2 protein. Length = 755 Score = 22.2 bits (45), Expect = 4.6 Identities = 12/56 (21%), Positives = 27/56 (48%) Frame = -1 Query: 254 PGLNFISVVLNVEEVTKLYSSPSLRSSTVGVTALAALRVISPTPSAFMKSSKFSDV 87 P N + ++ EVT++Y + + + T+ + V+SP+ K+ ++ V Sbjct: 260 PNTNQMGNIMTKSEVTQMYLTGNWYNYTIQSVSTVNKVVVSPSLVNSQKAMVYAQV 315 >AF281078-1|AAF82131.1| 2051|Anopheles gambiae vitellogenin 1 protein. Length = 2051 Score = 22.2 bits (45), Expect = 4.6 Identities = 12/56 (21%), Positives = 27/56 (48%) Frame = -1 Query: 254 PGLNFISVVLNVEEVTKLYSSPSLRSSTVGVTALAALRVISPTPSAFMKSSKFSDV 87 P N + ++ EVT++Y + + + T+ + V+SP+ K+ ++ V Sbjct: 260 PNTNQMGNIMTKSEVTQMYLTGNWYNYTIQSVSTVNKVVVSPSLVNSQKAMVYAQV 315 >AY825878-1|AAV70441.1| 161|Anopheles gambiae voltage gated sodium channel protein. Length = 161 Score = 21.8 bits (44), Expect = 6.1 Identities = 10/16 (62%), Positives = 12/16 (75%) Frame = -1 Query: 179 SSTVGVTALAALRVIS 132 SST+G+T L A VIS Sbjct: 11 SSTIGITYLLAYLVIS 26 >AY825877-1|AAV70440.1| 161|Anopheles gambiae voltage gated sodium channel protein. Length = 161 Score = 21.8 bits (44), Expect = 6.1 Identities = 10/16 (62%), Positives = 12/16 (75%) Frame = -1 Query: 179 SSTVGVTALAALRVIS 132 SST+G+T L A VIS Sbjct: 11 SSTIGITYLLAYLVIS 26 >AY825874-1|AAV70437.1| 162|Anopheles gambiae voltage gated sodium channel protein. Length = 162 Score = 21.8 bits (44), Expect = 6.1 Identities = 10/16 (62%), Positives = 12/16 (75%) Frame = -1 Query: 179 SSTVGVTALAALRVIS 132 SST+G+T L A VIS Sbjct: 12 SSTIGITYLLAYLVIS 27 >AY825873-1|AAV70436.1| 162|Anopheles gambiae voltage gated sodium channel protein. Length = 162 Score = 21.8 bits (44), Expect = 6.1 Identities = 10/16 (62%), Positives = 12/16 (75%) Frame = -1 Query: 179 SSTVGVTALAALRVIS 132 SST+G+T L A VIS Sbjct: 12 SSTIGITYLLAYLVIS 27 >AY825872-1|AAV70435.1| 162|Anopheles gambiae voltage gated sodium channel protein. Length = 162 Score = 21.8 bits (44), Expect = 6.1 Identities = 10/16 (62%), Positives = 12/16 (75%) Frame = -1 Query: 179 SSTVGVTALAALRVIS 132 SST+G+T L A VIS Sbjct: 12 SSTIGITYLLAYLVIS 27 >AY825871-1|AAV70434.1| 162|Anopheles gambiae voltage gated sodium channel protein. Length = 162 Score = 21.8 bits (44), Expect = 6.1 Identities = 10/16 (62%), Positives = 12/16 (75%) Frame = -1 Query: 179 SSTVGVTALAALRVIS 132 SST+G+T L A VIS Sbjct: 12 SSTIGITYLLAYLVIS 27 >AY825870-1|AAV70433.1| 161|Anopheles gambiae voltage gated sodium channel protein. Length = 161 Score = 21.8 bits (44), Expect = 6.1 Identities = 10/16 (62%), Positives = 12/16 (75%) Frame = -1 Query: 179 SSTVGVTALAALRVIS 132 SST+G+T L A VIS Sbjct: 11 SSTIGITYLLAYLVIS 26 >AY825869-1|AAV70432.1| 161|Anopheles gambiae voltage gated sodium channel protein. Length = 161 Score = 21.8 bits (44), Expect = 6.1 Identities = 10/16 (62%), Positives = 12/16 (75%) Frame = -1 Query: 179 SSTVGVTALAALRVIS 132 SST+G+T L A VIS Sbjct: 11 SSTIGITYLLAYLVIS 26 >AY825868-1|AAV70431.1| 161|Anopheles gambiae voltage gated sodium channel protein. Length = 161 Score = 21.8 bits (44), Expect = 6.1 Identities = 10/16 (62%), Positives = 12/16 (75%) Frame = -1 Query: 179 SSTVGVTALAALRVIS 132 SST+G+T L A VIS Sbjct: 11 SSTIGITYLLAYLVIS 26 >AY825867-1|AAV70430.1| 161|Anopheles gambiae voltage gated sodium channel protein. Length = 161 Score = 21.8 bits (44), Expect = 6.1 Identities = 10/16 (62%), Positives = 12/16 (75%) Frame = -1 Query: 179 SSTVGVTALAALRVIS 132 SST+G+T L A VIS Sbjct: 11 SSTIGITYLLAYLVIS 26 >AY825866-1|AAV70429.1| 161|Anopheles gambiae voltage gated sodium channel protein. Length = 161 Score = 21.8 bits (44), Expect = 6.1 Identities = 10/16 (62%), Positives = 12/16 (75%) Frame = -1 Query: 179 SSTVGVTALAALRVIS 132 SST+G+T L A VIS Sbjct: 11 SSTIGITYLLAYLVIS 26 >AY825865-1|AAV70428.1| 161|Anopheles gambiae voltage gated sodium channel protein. Length = 161 Score = 21.8 bits (44), Expect = 6.1 Identities = 10/16 (62%), Positives = 12/16 (75%) Frame = -1 Query: 179 SSTVGVTALAALRVIS 132 SST+G+T L A VIS Sbjct: 11 SSTIGITYLLAYLVIS 26 >AY825862-1|AAV70425.1| 162|Anopheles gambiae voltage gated sodium channel protein. Length = 162 Score = 21.8 bits (44), Expect = 6.1 Identities = 10/16 (62%), Positives = 12/16 (75%) Frame = -1 Query: 179 SSTVGVTALAALRVIS 132 SST+G+T L A VIS Sbjct: 12 SSTIGITYLLAYLVIS 27 >AY825861-1|AAV70424.1| 162|Anopheles gambiae voltage gated sodium channel protein. Length = 162 Score = 21.8 bits (44), Expect = 6.1 Identities = 10/16 (62%), Positives = 12/16 (75%) Frame = -1 Query: 179 SSTVGVTALAALRVIS 132 SST+G+T L A VIS Sbjct: 12 SSTIGITYLLAYLVIS 27 >AY825860-1|AAV70423.1| 161|Anopheles gambiae voltage gated sodium channel protein. Length = 161 Score = 21.8 bits (44), Expect = 6.1 Identities = 10/16 (62%), Positives = 12/16 (75%) Frame = -1 Query: 179 SSTVGVTALAALRVIS 132 SST+G+T L A VIS Sbjct: 12 SSTIGITYLLAYLVIS 27 >AY825859-1|AAV70422.1| 161|Anopheles gambiae voltage gated sodium channel protein. Length = 161 Score = 21.8 bits (44), Expect = 6.1 Identities = 10/16 (62%), Positives = 12/16 (75%) Frame = -1 Query: 179 SSTVGVTALAALRVIS 132 SST+G+T L A VIS Sbjct: 12 SSTIGITYLLAYLVIS 27 >AY825856-1|AAV70419.1| 166|Anopheles gambiae voltage gated sodium channel protein. Length = 166 Score = 21.8 bits (44), Expect = 6.1 Identities = 10/16 (62%), Positives = 12/16 (75%) Frame = -1 Query: 179 SSTVGVTALAALRVIS 132 SST+G+T L A VIS Sbjct: 12 SSTIGITYLLAYLVIS 27 >AY825855-1|AAV70418.1| 166|Anopheles gambiae voltage gated sodium channel protein. Length = 166 Score = 21.8 bits (44), Expect = 6.1 Identities = 10/16 (62%), Positives = 12/16 (75%) Frame = -1 Query: 179 SSTVGVTALAALRVIS 132 SST+G+T L A VIS Sbjct: 12 SSTIGITYLLAYLVIS 27 >AY825854-1|AAV70417.1| 161|Anopheles gambiae voltage gated sodium channel protein. Length = 161 Score = 21.8 bits (44), Expect = 6.1 Identities = 10/16 (62%), Positives = 12/16 (75%) Frame = -1 Query: 179 SSTVGVTALAALRVIS 132 SST+G+T L A VIS Sbjct: 11 SSTIGITYLLAYLVIS 26 >AY825853-1|AAV70416.1| 161|Anopheles gambiae voltage gated sodium channel protein. Length = 161 Score = 21.8 bits (44), Expect = 6.1 Identities = 10/16 (62%), Positives = 12/16 (75%) Frame = -1 Query: 179 SSTVGVTALAALRVIS 132 SST+G+T L A VIS Sbjct: 11 SSTIGITYLLAYLVIS 26 >AY825852-1|AAV70415.1| 161|Anopheles gambiae voltage gated sodium channel protein. Length = 161 Score = 21.8 bits (44), Expect = 6.1 Identities = 10/16 (62%), Positives = 12/16 (75%) Frame = -1 Query: 179 SSTVGVTALAALRVIS 132 SST+G+T L A VIS Sbjct: 11 SSTIGITYLLAYLVIS 26 >AY825851-1|AAV70414.1| 161|Anopheles gambiae voltage gated sodium channel protein. Length = 161 Score = 21.8 bits (44), Expect = 6.1 Identities = 10/16 (62%), Positives = 12/16 (75%) Frame = -1 Query: 179 SSTVGVTALAALRVIS 132 SST+G+T L A VIS Sbjct: 11 SSTIGITYLLAYLVIS 26 >AY825850-1|AAV70413.1| 161|Anopheles gambiae voltage gated sodium channel protein. Length = 161 Score = 21.8 bits (44), Expect = 6.1 Identities = 10/16 (62%), Positives = 12/16 (75%) Frame = -1 Query: 179 SSTVGVTALAALRVIS 132 SST+G+T L A VIS Sbjct: 11 SSTIGITYLLAYLVIS 26 >AY825849-1|AAV70412.1| 161|Anopheles gambiae voltage gated sodium channel protein. Length = 161 Score = 21.8 bits (44), Expect = 6.1 Identities = 10/16 (62%), Positives = 12/16 (75%) Frame = -1 Query: 179 SSTVGVTALAALRVIS 132 SST+G+T L A VIS Sbjct: 11 SSTIGITYLLAYLVIS 26 >AY825848-1|AAV70411.1| 160|Anopheles gambiae voltage gated sodium channel protein. Length = 160 Score = 21.8 bits (44), Expect = 6.1 Identities = 10/16 (62%), Positives = 12/16 (75%) Frame = -1 Query: 179 SSTVGVTALAALRVIS 132 SST+G+T L A VIS Sbjct: 10 SSTIGITYLLAYLVIS 25 >AY825847-1|AAV70410.1| 160|Anopheles gambiae voltage gated sodium channel protein. Length = 160 Score = 21.8 bits (44), Expect = 6.1 Identities = 10/16 (62%), Positives = 12/16 (75%) Frame = -1 Query: 179 SSTVGVTALAALRVIS 132 SST+G+T L A VIS Sbjct: 10 SSTIGITYLLAYLVIS 25 >AY825846-1|AAV70409.1| 161|Anopheles gambiae voltage gated sodium channel protein. Length = 161 Score = 21.8 bits (44), Expect = 6.1 Identities = 10/16 (62%), Positives = 12/16 (75%) Frame = -1 Query: 179 SSTVGVTALAALRVIS 132 SST+G+T L A VIS Sbjct: 12 SSTIGITYLLAYLVIS 27 >AY825845-1|AAV70408.1| 161|Anopheles gambiae voltage gated sodium channel protein. Length = 161 Score = 21.8 bits (44), Expect = 6.1 Identities = 10/16 (62%), Positives = 12/16 (75%) Frame = -1 Query: 179 SSTVGVTALAALRVIS 132 SST+G+T L A VIS Sbjct: 12 SSTIGITYLLAYLVIS 27 >AY825844-1|AAV70407.1| 161|Anopheles gambiae voltage gated sodium channel protein. Length = 161 Score = 21.8 bits (44), Expect = 6.1 Identities = 10/16 (62%), Positives = 12/16 (75%) Frame = -1 Query: 179 SSTVGVTALAALRVIS 132 SST+G+T L A VIS Sbjct: 12 SSTIGITYLLAYLVIS 27 >AY825843-1|AAV70406.1| 161|Anopheles gambiae voltage gated sodium channel protein. Length = 161 Score = 21.8 bits (44), Expect = 6.1 Identities = 10/16 (62%), Positives = 12/16 (75%) Frame = -1 Query: 179 SSTVGVTALAALRVIS 132 SST+G+T L A VIS Sbjct: 12 SSTIGITYLLAYLVIS 27 >AY825842-1|AAV70405.1| 160|Anopheles gambiae voltage gated sodium channel protein. Length = 160 Score = 21.8 bits (44), Expect = 6.1 Identities = 10/16 (62%), Positives = 12/16 (75%) Frame = -1 Query: 179 SSTVGVTALAALRVIS 132 SST+G+T L A VIS Sbjct: 11 SSTIGITYLLAYLVIS 26 >AY825841-1|AAV70404.1| 160|Anopheles gambiae voltage gated sodium channel protein. Length = 160 Score = 21.8 bits (44), Expect = 6.1 Identities = 10/16 (62%), Positives = 12/16 (75%) Frame = -1 Query: 179 SSTVGVTALAALRVIS 132 SST+G+T L A VIS Sbjct: 11 SSTIGITYLLAYLVIS 26 >AY825840-1|AAV70403.1| 161|Anopheles gambiae voltage gated sodium channel protein. Length = 161 Score = 21.8 bits (44), Expect = 6.1 Identities = 10/16 (62%), Positives = 12/16 (75%) Frame = -1 Query: 179 SSTVGVTALAALRVIS 132 SST+G+T L A VIS Sbjct: 11 SSTIGITYLLAYLVIS 26 >AY825839-1|AAV70402.1| 161|Anopheles gambiae voltage gated sodium channel protein. Length = 161 Score = 21.8 bits (44), Expect = 6.1 Identities = 10/16 (62%), Positives = 12/16 (75%) Frame = -1 Query: 179 SSTVGVTALAALRVIS 132 SST+G+T L A VIS Sbjct: 11 SSTIGITYLLAYLVIS 26 >AY825838-1|AAV70401.1| 162|Anopheles gambiae voltage gated sodium channel protein. Length = 162 Score = 21.8 bits (44), Expect = 6.1 Identities = 10/16 (62%), Positives = 12/16 (75%) Frame = -1 Query: 179 SSTVGVTALAALRVIS 132 SST+G+T L A VIS Sbjct: 12 SSTIGITYLLAYLVIS 27 >AY825837-1|AAV70400.1| 162|Anopheles gambiae voltage gated sodium channel protein. Length = 162 Score = 21.8 bits (44), Expect = 6.1 Identities = 10/16 (62%), Positives = 12/16 (75%) Frame = -1 Query: 179 SSTVGVTALAALRVIS 132 SST+G+T L A VIS Sbjct: 12 SSTIGITYLLAYLVIS 27 >AY825836-1|AAV70399.1| 161|Anopheles gambiae voltage gated sodium channel protein. Length = 161 Score = 21.8 bits (44), Expect = 6.1 Identities = 10/16 (62%), Positives = 12/16 (75%) Frame = -1 Query: 179 SSTVGVTALAALRVIS 132 SST+G+T L A VIS Sbjct: 11 SSTIGITYLLAYLVIS 26 >AY825835-1|AAV70398.1| 161|Anopheles gambiae voltage gated sodium channel protein. Length = 161 Score = 21.8 bits (44), Expect = 6.1 Identities = 10/16 (62%), Positives = 12/16 (75%) Frame = -1 Query: 179 SSTVGVTALAALRVIS 132 SST+G+T L A VIS Sbjct: 11 SSTIGITYLLAYLVIS 26 >AY825834-1|AAV70397.1| 161|Anopheles gambiae voltage gated sodium channel protein. Length = 161 Score = 21.8 bits (44), Expect = 6.1 Identities = 10/16 (62%), Positives = 12/16 (75%) Frame = -1 Query: 179 SSTVGVTALAALRVIS 132 SST+G+T L A VIS Sbjct: 11 SSTIGITYLLAYLVIS 26 >AY825833-1|AAV70396.1| 161|Anopheles gambiae voltage gated sodium channel protein. Length = 161 Score = 21.8 bits (44), Expect = 6.1 Identities = 10/16 (62%), Positives = 12/16 (75%) Frame = -1 Query: 179 SSTVGVTALAALRVIS 132 SST+G+T L A VIS Sbjct: 11 SSTIGITYLLAYLVIS 26 >AM422833-1|CAM12801.1| 2139|Anopheles gambiae voltage-gated sodium channel alpha subunitprotein. Length = 2139 Score = 21.8 bits (44), Expect = 6.1 Identities = 10/16 (62%), Positives = 12/16 (75%) Frame = -1 Query: 179 SSTVGVTALAALRVIS 132 SST+G+T L A VIS Sbjct: 1836 SSTIGITYLLAYLVIS 1851 >EF426168-1|ABO26411.1| 155|Anopheles gambiae unknown protein. Length = 155 Score = 21.4 bits (43), Expect = 8.1 Identities = 8/24 (33%), Positives = 15/24 (62%) Frame = -3 Query: 225 ECRRGDEIVFVTFLAQLHGWGHSI 154 +C+ G ++V T +Q+ GHS+ Sbjct: 40 DCQAGAQLVECTSASQMSIMGHSL 63 >AY341205-1|AAR13769.1| 285|Anopheles gambiae period protein. Length = 285 Score = 21.4 bits (43), Expect = 8.1 Identities = 12/41 (29%), Positives = 19/41 (46%) Frame = -1 Query: 227 LNVEEVTKLYSSPSLRSSTVGVTALAALRVISPTPSAFMKS 105 +N+EE K+ SS + T+G + +SP F S Sbjct: 183 MNIEEQMKMDSSGGTNTETIGDEQQS--HAVSPNQRGFSAS 221 >AY341204-1|AAR13768.1| 285|Anopheles gambiae period protein. Length = 285 Score = 21.4 bits (43), Expect = 8.1 Identities = 12/41 (29%), Positives = 19/41 (46%) Frame = -1 Query: 227 LNVEEVTKLYSSPSLRSSTVGVTALAALRVISPTPSAFMKS 105 +N+EE K+ SS + T+G + +SP F S Sbjct: 183 MNIEEQMKMDSSGGTNTETIGDEQQS--HAVSPNQRGFSAS 221 >AY341203-1|AAR13767.1| 285|Anopheles gambiae period protein. Length = 285 Score = 21.4 bits (43), Expect = 8.1 Identities = 12/41 (29%), Positives = 19/41 (46%) Frame = -1 Query: 227 LNVEEVTKLYSSPSLRSSTVGVTALAALRVISPTPSAFMKS 105 +N+EE K+ SS + T+G + +SP F S Sbjct: 183 MNIEEQMKMDSSGGTNTETIGDEQQS--HAVSPNQRGFSAS 221 >AY341202-1|AAR13766.1| 285|Anopheles gambiae period protein. Length = 285 Score = 21.4 bits (43), Expect = 8.1 Identities = 12/41 (29%), Positives = 19/41 (46%) Frame = -1 Query: 227 LNVEEVTKLYSSPSLRSSTVGVTALAALRVISPTPSAFMKS 105 +N+EE K+ SS + T+G + +SP F S Sbjct: 183 MNIEEQMKMDSSGGTNTETIGDEQQS--HAVSPNQRGFSAS 221 >AY341160-1|AAR13724.1| 159|Anopheles gambiae CED6 protein. Length = 159 Score = 21.4 bits (43), Expect = 8.1 Identities = 8/20 (40%), Positives = 10/20 (50%) Frame = +1 Query: 145 KAANAVTPTVELRKEGDEYN 204 K VTPT + GD+ N Sbjct: 89 KTGTGVTPTSSIASSGDDTN 108 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 303,432 Number of Sequences: 2352 Number of extensions: 5876 Number of successful extensions: 60 Number of sequences better than 10.0: 57 Number of HSP's better than 10.0 without gapping: 60 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 60 length of database: 563,979 effective HSP length: 56 effective length of database: 432,267 effective search space used: 20316549 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -