BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= S06A01NCLL0001_M15 (311 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At3g48770.1 68416.m05326 hypothetical protein 29 0.50 At3g01880.1 68416.m00133 hypothetical protein 29 0.66 At3g45120.1 68416.m04870 hypothetical protein 28 1.5 At3g06020.1 68416.m00687 expressed protein ; expression supporte... 27 2.6 At1g69850.1 68414.m08039 nitrate transporter (NTL1) identical to... 27 2.6 At3g01870.1 68416.m00132 hypothetical protein 27 3.5 At1g27040.2 68414.m03296 nitrate transporter, putative contains ... 27 3.5 At1g27040.1 68414.m03297 nitrate transporter, putative contains ... 27 3.5 At2g47800.1 68415.m05966 glutathione-conjugate transporter (MRP4... 26 6.1 At1g75770.1 68414.m08800 expressed protein 26 6.1 At5g46490.2 68418.m05725 disease resistance protein (TIR-NBS cla... 25 8.1 At5g46490.1 68418.m05724 disease resistance protein (TIR-NBS cla... 25 8.1 At4g32720.1 68417.m04657 RNA recognition motif (RRM)-containing ... 25 8.1 At3g05660.1 68416.m00630 disease resistance family protein conta... 25 8.1 >At3g48770.1 68416.m05326 hypothetical protein Length = 1899 Score = 29.5 bits (63), Expect = 0.50 Identities = 22/73 (30%), Positives = 35/73 (47%), Gaps = 4/73 (5%) Frame = +1 Query: 22 FDRTNKNLPLAMDFIGKKYKMTTSENFDDFMKALGVGLITRKAANAVTPTVELRKEGDE- 198 FDRT K P FI ++Y + +F + + A+GVG + KA + V E D Sbjct: 1455 FDRTWKLEPCDGPFIDEEYYGSDINSFREELIAIGVGHDSDKACQLLARNVYKLSETDAI 1514 Query: 199 ---YNFVTSSTFK 228 Y F++ + +K Sbjct: 1515 SRVYRFLSEAEWK 1527 >At3g01880.1 68416.m00133 hypothetical protein Length = 592 Score = 29.1 bits (62), Expect = 0.66 Identities = 12/35 (34%), Positives = 20/35 (57%) Frame = -1 Query: 113 MKSSKFSDVVILYFLPMKSMAKGRFLFVRSKNASN 9 M + F+D+V+ F P A +FLF++S + N Sbjct: 384 MFGATFTDIVVWLFFPYNGNAHLKFLFIKSLSLGN 418 >At3g45120.1 68416.m04870 hypothetical protein Length = 106 Score = 27.9 bits (59), Expect = 1.5 Identities = 10/33 (30%), Positives = 22/33 (66%) Frame = -3 Query: 201 VFVTFLAQLHGWGHSISRLAGDQSHTECLHEIV 103 +FV+F+ + G+++SR GD + ++C+ + V Sbjct: 35 LFVSFITTVKTLGNNVSRTHGDDAESDCVCDSV 67 >At3g06020.1 68416.m00687 expressed protein ; expression supported by MPSS Length = 300 Score = 27.1 bits (57), Expect = 2.6 Identities = 14/43 (32%), Positives = 23/43 (53%) Frame = +1 Query: 175 ELRKEGDEYNFVTSSTFKTTEMKFKPGEEFEEERADGVKVKSV 303 E ++E +E T T + E + +E EEE+ + +KVK V Sbjct: 228 ETKEEKEEEEEETIETVRDNEEEIPEYKEEEEEKEEEIKVKGV 270 >At1g69850.1 68414.m08039 nitrate transporter (NTL1) identical to nitrate transporter (NTL1) GI:3377517 [Arabidopsis thaliana] Length = 585 Score = 27.1 bits (57), Expect = 2.6 Identities = 13/38 (34%), Positives = 22/38 (57%) Frame = +1 Query: 79 KMTTSENFDDFMKALGVGLITRKAANAVTPTVELRKEG 192 K T +E ++ +GVGL+ A AV VE++++G Sbjct: 414 KATKTETGVTHLQRIGVGLVLSILAMAVAALVEIKRKG 451 >At3g01870.1 68416.m00132 hypothetical protein Length = 583 Score = 26.6 bits (56), Expect = 3.5 Identities = 11/30 (36%), Positives = 17/30 (56%) Frame = -1 Query: 113 MKSSKFSDVVILYFLPMKSMAKGRFLFVRS 24 M F+D+V+ F P A+ +FLF +S Sbjct: 379 MFGGTFTDIVVWIFYPFNGNARLKFLFFKS 408 >At1g27040.2 68414.m03296 nitrate transporter, putative contains Pfam profile: PF00854 POT family; similar to nitrate transporter (NTL1) GI:3377517 [Arabidopsis thaliana] Length = 563 Score = 26.6 bits (56), Expect = 3.5 Identities = 14/37 (37%), Positives = 22/37 (59%) Frame = +1 Query: 79 KMTTSENFDDFMKALGVGLITRKAANAVTPTVELRKE 189 K+T SE ++ +GVGL+ A AV VEL+++ Sbjct: 393 KVTKSEIGITHLQRIGVGLVLSIVAMAVAALVELKRK 429 >At1g27040.1 68414.m03297 nitrate transporter, putative contains Pfam profile: PF00854 POT family; similar to nitrate transporter (NTL1) GI:3377517 [Arabidopsis thaliana] Length = 567 Score = 26.6 bits (56), Expect = 3.5 Identities = 14/37 (37%), Positives = 22/37 (59%) Frame = +1 Query: 79 KMTTSENFDDFMKALGVGLITRKAANAVTPTVELRKE 189 K+T SE ++ +GVGL+ A AV VEL+++ Sbjct: 397 KVTKSEIGITHLQRIGVGLVLSIVAMAVAALVELKRK 433 >At2g47800.1 68415.m05966 glutathione-conjugate transporter (MRP4) identical to AtMRP4 GI:2959767 from [Arabidopsis thaliana] Length = 1516 Score = 25.8 bits (54), Expect = 6.1 Identities = 19/55 (34%), Positives = 25/55 (45%), Gaps = 4/55 (7%) Frame = -1 Query: 227 LNVEEVTKLYSSPS----LRSSTVGVTALAALRVISPTPSAFMKSSKFSDVVILY 75 L E+V +S P L +S G+T L SPT + S + SD V LY Sbjct: 198 LRAEDVASFFSFPLTAFLLIASVRGITGLVTAETNSPTKPSDAVSVEKSDNVSLY 252 >At1g75770.1 68414.m08800 expressed protein Length = 230 Score = 25.8 bits (54), Expect = 6.1 Identities = 12/59 (20%), Positives = 26/59 (44%) Frame = -3 Query: 264 EFFTRLELHLRGLECRRGDEIVFVTFLAQLHGWGHSISRLAGDQSHTECLHEIVEVLGC 88 +FF ++ + + + ++F + LH WG + R + SH +++ L C Sbjct: 25 DFFDSIDYEISSILLQLSHPVIFSSDSPVLHKWGRTKKR-SSSSSHLHPPEPVIKSLPC 82 >At5g46490.2 68418.m05725 disease resistance protein (TIR-NBS class), putative domain signature TIR-NBS exists, suggestive of a disease resistance protein. Length = 858 Score = 25.4 bits (53), Expect = 8.1 Identities = 14/37 (37%), Positives = 23/37 (62%), Gaps = 1/37 (2%) Frame = +1 Query: 7 GFD-AFFDRTNKNLPLAMDFIGKKYKMTTSENFDDFM 114 GFD A +D K + + + +K +TTS++FDDF+ Sbjct: 147 GFDSAKWDDEAKMIEEIANDVLRKLLLTTSKDFDDFV 183 >At5g46490.1 68418.m05724 disease resistance protein (TIR-NBS class), putative domain signature TIR-NBS exists, suggestive of a disease resistance protein. Length = 357 Score = 25.4 bits (53), Expect = 8.1 Identities = 14/37 (37%), Positives = 23/37 (62%), Gaps = 1/37 (2%) Frame = +1 Query: 7 GFD-AFFDRTNKNLPLAMDFIGKKYKMTTSENFDDFM 114 GFD A +D K + + + +K +TTS++FDDF+ Sbjct: 147 GFDSAKWDDEAKMIEEIANDVLRKLLLTTSKDFDDFV 183 >At4g32720.1 68417.m04657 RNA recognition motif (RRM)-containing protein RNA-binding protein LAH1, Saccharomyces cerevisiae, PIR2:B48600; contains InterPro entry IPR000504: RNA-binding region RNP-1 (RNA recognition motif) (RRM) Length = 433 Score = 25.4 bits (53), Expect = 8.1 Identities = 16/42 (38%), Positives = 22/42 (52%), Gaps = 2/42 (4%) Frame = +1 Query: 172 VELRKEGDEYNFVTSS-TFKTTEMKFKPGEEFEEER-ADGVK 291 VE E D N + + F E++ KP +EF+ ER D VK Sbjct: 163 VEFPTEEDAQNVMKQNLVFAGQELELKPKKEFDNEREKDEVK 204 >At3g05660.1 68416.m00630 disease resistance family protein contains leucine rich-repeat (LRR) domains Pfam:PF00560, INTERPRO:IPR001611; similar to Cf-2.2 [Lycopersicon pimpinellifolium] gi|1184077|gb|AAC15780 Length = 883 Score = 25.4 bits (53), Expect = 8.1 Identities = 13/35 (37%), Positives = 18/35 (51%), Gaps = 2/35 (5%) Frame = -3 Query: 240 HLRGLEC--RRGDEIVFVTFLAQLHGWGHSISRLA 142 H G+ C + G+ I + LHGW HS S L+ Sbjct: 71 HWDGITCDAKTGEVIEIDLMCSCLHGWFHSNSNLS 105 Database: arabidopsis Posted date: Oct 4, 2007 10:56 AM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 6,465,173 Number of Sequences: 28952 Number of extensions: 123618 Number of successful extensions: 373 Number of sequences better than 10.0: 14 Number of HSP's better than 10.0 without gapping: 367 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 373 length of database: 12,070,560 effective HSP length: 70 effective length of database: 10,043,920 effective search space used: 331449360 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -