BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= S06A01NCLL0001_M10 (496 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value CR954257-2|CAJ14153.1| 1664|Anopheles gambiae Tubby protein. 23 4.3 AF281078-2|AAF82132.1| 755|Anopheles gambiae vitellogenin 2 pro... 23 5.7 AF281078-1|AAF82131.1| 2051|Anopheles gambiae vitellogenin 1 pro... 23 5.7 AJ441131-5|CAD29634.1| 574|Anopheles gambiae putative Na+ chann... 22 10.0 AJ439398-4|CAD28127.1| 572|Anopheles gambiae putative sodium ch... 22 10.0 >CR954257-2|CAJ14153.1| 1664|Anopheles gambiae Tubby protein. Length = 1664 Score = 23.4 bits (48), Expect = 4.3 Identities = 9/41 (21%), Positives = 14/41 (34%) Frame = +3 Query: 369 FIYYQPKVKNLKTKATMKGYHXXXXXXXXXXXXXNHHTIGT 491 F+ + P+V + T T +H T GT Sbjct: 457 FVIFDPQVDEVSTYCTYSSDSTTTTTTTKSASTSSHSTTGT 497 >AF281078-2|AAF82132.1| 755|Anopheles gambiae vitellogenin 2 protein. Length = 755 Score = 23.0 bits (47), Expect = 5.7 Identities = 10/30 (33%), Positives = 18/30 (60%) Frame = +2 Query: 383 AKSEKLENESDDEGLSFKEKKAKRLKAQAK 472 + S+ + S++E +FK A++ K QAK Sbjct: 382 SSSDSSSSSSEEEAENFKISPAEQYKKQAK 411 >AF281078-1|AAF82131.1| 2051|Anopheles gambiae vitellogenin 1 protein. Length = 2051 Score = 23.0 bits (47), Expect = 5.7 Identities = 10/30 (33%), Positives = 18/30 (60%) Frame = +2 Query: 383 AKSEKLENESDDEGLSFKEKKAKRLKAQAK 472 + S+ + S++E +FK A++ K QAK Sbjct: 382 SSSDSSSSSSEEEAENFKISTAEQYKKQAK 411 >AJ441131-5|CAD29634.1| 574|Anopheles gambiae putative Na+ channel protein. Length = 574 Score = 22.2 bits (45), Expect = 10.0 Identities = 7/16 (43%), Positives = 11/16 (68%) Frame = +3 Query: 345 VLLSAVGCFIYYQPKV 392 ++L GC +YY PK+ Sbjct: 374 LILENCGCVLYYLPKL 389 >AJ439398-4|CAD28127.1| 572|Anopheles gambiae putative sodium channel protein. Length = 572 Score = 22.2 bits (45), Expect = 10.0 Identities = 7/16 (43%), Positives = 11/16 (68%) Frame = +3 Query: 345 VLLSAVGCFIYYQPKV 392 ++L GC +YY PK+ Sbjct: 374 LILENCGCVLYYLPKL 389 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 400,241 Number of Sequences: 2352 Number of extensions: 7422 Number of successful extensions: 16 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 16 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 16 length of database: 563,979 effective HSP length: 60 effective length of database: 422,859 effective search space used: 43977336 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -