BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= S06A01NCLL0001_M07 (307 letters) Database: human 237,096 sequences; 76,859,062 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value DQ644022-1|ABG35128.1| 456|Homo sapiens 5-HT3 receptor subunit ... 31 0.66 BC101185-1|AAI01186.1| 374|Homo sapiens HTR3E protein protein. 31 0.66 BC101183-1|AAI01184.1| 471|Homo sapiens 5-hydroxytryptamine (se... 31 0.66 BC101182-1|AAI01183.1| 471|Homo sapiens 5-hydroxytryptamine (se... 31 0.66 AY349353-1|AAQ93477.1| 456|Homo sapiens 5-HT3c1 serotonin recep... 31 0.66 AY349352-1|AAQ93476.1| 441|Homo sapiens 5-HT3c1 serotonin recep... 31 0.66 AY159813-1|AAO38167.2| 471|Homo sapiens 5-hydroxytryptamine ser... 31 0.66 BC131799-1|AAI31800.1| 447|Homo sapiens 5-hydroxytryptamine (se... 30 1.2 AF459285-1|AAL66182.1| 447|Homo sapiens 5-hydroxytryptamine rec... 30 1.2 BX897730-1|CAM26290.1| 425|Homo sapiens tripartite motif-contai... 29 3.5 BX322644-1|CAI18447.1| 425|Homo sapiens tripartite motif-contai... 29 3.5 BX088647-1|CAM26282.1| 425|Homo sapiens tripartite motif-contai... 29 3.5 BX005441-1|CAM26234.1| 425|Homo sapiens tripartite motif-contai... 29 3.5 BT006675-1|AAP35321.1| 425|Homo sapiens tripartite motif-contai... 29 3.5 BC017017-1|AAH17017.1| 425|Homo sapiens tripartite motif-contai... 29 3.5 AL671859-7|CAI17583.1| 425|Homo sapiens tripartite motif-contai... 29 3.5 AL669914-7|CAI18183.1| 425|Homo sapiens tripartite motif-contai... 29 3.5 AK222729-1|BAD96449.1| 425|Homo sapiens tripartite motif protei... 29 3.5 AF230386-1|AAG50165.1| 425|Homo sapiens tripartite motif protei... 29 3.5 AB202083-1|BAE78603.1| 425|Homo sapiens tripartite motif-contai... 29 3.5 >DQ644022-1|ABG35128.1| 456|Homo sapiens 5-HT3 receptor subunit E splice variant HTR3Ea protein. Length = 456 Score = 31.1 bits (67), Expect = 0.66 Identities = 12/40 (30%), Positives = 21/40 (52%) Frame = -3 Query: 170 VDFFGTPFSTRGIISCFLCFIFKFDACSVSLKKRVWVLTD 51 +D F PF + F F++ D+ + ++K VW +TD Sbjct: 164 LDIFYFPFDQQNCTLTFSSFLYTVDSMLLDMEKEVWEITD 203 >BC101185-1|AAI01186.1| 374|Homo sapiens HTR3E protein protein. Length = 374 Score = 31.1 bits (67), Expect = 0.66 Identities = 12/40 (30%), Positives = 21/40 (52%) Frame = -3 Query: 170 VDFFGTPFSTRGIISCFLCFIFKFDACSVSLKKRVWVLTD 51 +D F PF + F F++ D+ + ++K VW +TD Sbjct: 93 LDIFYFPFDQQNCTLTFSSFLYTVDSMLLDMEKEVWEITD 132 >BC101183-1|AAI01184.1| 471|Homo sapiens 5-hydroxytryptamine (serotonin) receptor 3, family member E protein. Length = 471 Score = 31.1 bits (67), Expect = 0.66 Identities = 12/40 (30%), Positives = 21/40 (52%) Frame = -3 Query: 170 VDFFGTPFSTRGIISCFLCFIFKFDACSVSLKKRVWVLTD 51 +D F PF + F F++ D+ + ++K VW +TD Sbjct: 179 LDIFYFPFDQQNCTLTFSSFLYTVDSMLLDMEKEVWEITD 218 >BC101182-1|AAI01183.1| 471|Homo sapiens 5-hydroxytryptamine (serotonin) receptor 3, family member E protein. Length = 471 Score = 31.1 bits (67), Expect = 0.66 Identities = 12/40 (30%), Positives = 21/40 (52%) Frame = -3 Query: 170 VDFFGTPFSTRGIISCFLCFIFKFDACSVSLKKRVWVLTD 51 +D F PF + F F++ D+ + ++K VW +TD Sbjct: 179 LDIFYFPFDQQNCTLTFSSFLYTVDSMLLDMEKEVWEITD 218 >AY349353-1|AAQ93477.1| 456|Homo sapiens 5-HT3c1 serotonin receptor-like protein protein. Length = 456 Score = 31.1 bits (67), Expect = 0.66 Identities = 12/40 (30%), Positives = 21/40 (52%) Frame = -3 Query: 170 VDFFGTPFSTRGIISCFLCFIFKFDACSVSLKKRVWVLTD 51 +D F PF + F F++ D+ + ++K VW +TD Sbjct: 164 LDIFYFPFDQQNCTLTFSSFLYTVDSMLLDMEKEVWEITD 203 >AY349352-1|AAQ93476.1| 441|Homo sapiens 5-HT3c1 serotonin receptor-like protein protein. Length = 441 Score = 31.1 bits (67), Expect = 0.66 Identities = 12/40 (30%), Positives = 21/40 (52%) Frame = -3 Query: 170 VDFFGTPFSTRGIISCFLCFIFKFDACSVSLKKRVWVLTD 51 +D F PF + F F++ D+ + ++K VW +TD Sbjct: 149 LDIFYFPFDQQNCTLTFSSFLYTVDSMLLDMEKEVWEITD 188 >AY159813-1|AAO38167.2| 471|Homo sapiens 5-hydroxytryptamine serotonin receptor 3E protein. Length = 471 Score = 31.1 bits (67), Expect = 0.66 Identities = 12/40 (30%), Positives = 21/40 (52%) Frame = -3 Query: 170 VDFFGTPFSTRGIISCFLCFIFKFDACSVSLKKRVWVLTD 51 +D F PF + F F++ D+ + ++K VW +TD Sbjct: 179 LDIFYFPFDQQNCTLTFSSFLYTVDSMLLDMEKEVWEITD 218 >BC131799-1|AAI31800.1| 447|Homo sapiens 5-hydroxytryptamine (serotonin) receptor 3, family member C protein. Length = 447 Score = 30.3 bits (65), Expect = 1.2 Identities = 12/40 (30%), Positives = 20/40 (50%) Frame = -3 Query: 170 VDFFGTPFSTRGIISCFLCFIFKFDACSVSLKKRVWVLTD 51 +D F PF + F F++ D+ + + K VW +TD Sbjct: 164 LDIFYFPFDQQNCTFTFSSFLYTVDSMLLGMDKEVWEITD 203 >AF459285-1|AAL66182.1| 447|Homo sapiens 5-hydroxytryptamine receptor 3 subunit C protein. Length = 447 Score = 30.3 bits (65), Expect = 1.2 Identities = 12/40 (30%), Positives = 20/40 (50%) Frame = -3 Query: 170 VDFFGTPFSTRGIISCFLCFIFKFDACSVSLKKRVWVLTD 51 +D F PF + F F++ D+ + + K VW +TD Sbjct: 164 LDIFYFPFDQQNCTFTFSSFLYTVDSMLLGMDKEVWEITD 203 >BX897730-1|CAM26290.1| 425|Homo sapiens tripartite motif-containing 31 protein. Length = 425 Score = 28.7 bits (61), Expect = 3.5 Identities = 13/41 (31%), Positives = 19/41 (46%) Frame = +3 Query: 72 FFKRNATSVELEDKTEKTRNNSSSTEGSTEKIYDNISIDRK 194 F +ELE K + ++ S GS +K D + DRK Sbjct: 262 FLNPTPVPLELEKKLSEAKSRHDSITGSLKKFKDQLQADRK 302 >BX322644-1|CAI18447.1| 425|Homo sapiens tripartite motif-containing 31 protein. Length = 425 Score = 28.7 bits (61), Expect = 3.5 Identities = 13/41 (31%), Positives = 19/41 (46%) Frame = +3 Query: 72 FFKRNATSVELEDKTEKTRNNSSSTEGSTEKIYDNISIDRK 194 F +ELE K + ++ S GS +K D + DRK Sbjct: 262 FLNPTPVPLELEKKLSEAKSRHDSITGSLKKFKDQLQADRK 302 >BX088647-1|CAM26282.1| 425|Homo sapiens tripartite motif-containing 31 protein. Length = 425 Score = 28.7 bits (61), Expect = 3.5 Identities = 13/41 (31%), Positives = 19/41 (46%) Frame = +3 Query: 72 FFKRNATSVELEDKTEKTRNNSSSTEGSTEKIYDNISIDRK 194 F +ELE K + ++ S GS +K D + DRK Sbjct: 262 FLNPTPVPLELEKKLSEAKSRHDSITGSLKKFKDQLQADRK 302 >BX005441-1|CAM26234.1| 425|Homo sapiens tripartite motif-containing 31 protein. Length = 425 Score = 28.7 bits (61), Expect = 3.5 Identities = 13/41 (31%), Positives = 19/41 (46%) Frame = +3 Query: 72 FFKRNATSVELEDKTEKTRNNSSSTEGSTEKIYDNISIDRK 194 F +ELE K + ++ S GS +K D + DRK Sbjct: 262 FLNPTPVPLELEKKLSEAKSRHDSITGSLKKFKDQLQADRK 302 >BT006675-1|AAP35321.1| 425|Homo sapiens tripartite motif-containing 31 protein. Length = 425 Score = 28.7 bits (61), Expect = 3.5 Identities = 13/41 (31%), Positives = 19/41 (46%) Frame = +3 Query: 72 FFKRNATSVELEDKTEKTRNNSSSTEGSTEKIYDNISIDRK 194 F +ELE K + ++ S GS +K D + DRK Sbjct: 262 FLNPTPVPLELEKKLSEAKSRHDSITGSLKKFKDQLQADRK 302 >BC017017-1|AAH17017.1| 425|Homo sapiens tripartite motif-containing 31 protein. Length = 425 Score = 28.7 bits (61), Expect = 3.5 Identities = 13/41 (31%), Positives = 19/41 (46%) Frame = +3 Query: 72 FFKRNATSVELEDKTEKTRNNSSSTEGSTEKIYDNISIDRK 194 F +ELE K + ++ S GS +K D + DRK Sbjct: 262 FLNPTPVPLELEKKLSEAKSRHDSITGSLKKFKDQLQADRK 302 >AL671859-7|CAI17583.1| 425|Homo sapiens tripartite motif-containing 31 protein. Length = 425 Score = 28.7 bits (61), Expect = 3.5 Identities = 13/41 (31%), Positives = 19/41 (46%) Frame = +3 Query: 72 FFKRNATSVELEDKTEKTRNNSSSTEGSTEKIYDNISIDRK 194 F +ELE K + ++ S GS +K D + DRK Sbjct: 262 FLNPTPVPLELEKKLSEAKSRHDSITGSLKKFKDQLQADRK 302 >AL669914-7|CAI18183.1| 425|Homo sapiens tripartite motif-containing 31 protein. Length = 425 Score = 28.7 bits (61), Expect = 3.5 Identities = 13/41 (31%), Positives = 19/41 (46%) Frame = +3 Query: 72 FFKRNATSVELEDKTEKTRNNSSSTEGSTEKIYDNISIDRK 194 F +ELE K + ++ S GS +K D + DRK Sbjct: 262 FLNPTPVPLELEKKLSEAKSRHDSITGSLKKFKDQLQADRK 302 >AK222729-1|BAD96449.1| 425|Homo sapiens tripartite motif protein 31 isoform alpha variant protein. Length = 425 Score = 28.7 bits (61), Expect = 3.5 Identities = 13/41 (31%), Positives = 19/41 (46%) Frame = +3 Query: 72 FFKRNATSVELEDKTEKTRNNSSSTEGSTEKIYDNISIDRK 194 F +ELE K + ++ S GS +K D + DRK Sbjct: 262 FLNPTPVPLELEKKLSEAKSRHDSITGSLKKFKDQLQADRK 302 >AF230386-1|AAG50165.1| 425|Homo sapiens tripartite motif protein TRIM31 alpha protein. Length = 425 Score = 28.7 bits (61), Expect = 3.5 Identities = 13/41 (31%), Positives = 19/41 (46%) Frame = +3 Query: 72 FFKRNATSVELEDKTEKTRNNSSSTEGSTEKIYDNISIDRK 194 F +ELE K + ++ S GS +K D + DRK Sbjct: 262 FLNPTPVPLELEKKLSEAKSRHDSITGSLKKFKDQLQADRK 302 >AB202083-1|BAE78603.1| 425|Homo sapiens tripartite motif-containing 31 protein. Length = 425 Score = 28.7 bits (61), Expect = 3.5 Identities = 13/41 (31%), Positives = 19/41 (46%) Frame = +3 Query: 72 FFKRNATSVELEDKTEKTRNNSSSTEGSTEKIYDNISIDRK 194 F +ELE K + ++ S GS +K D + DRK Sbjct: 262 FLNPTPVPLELEKKLSEAKSRHDSITGSLKKFKDQLQADRK 302 Database: human Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 76,859,062 Number of sequences in database: 237,096 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 31,099,911 Number of Sequences: 237096 Number of extensions: 452955 Number of successful extensions: 1260 Number of sequences better than 10.0: 20 Number of HSP's better than 10.0 without gapping: 1228 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1260 length of database: 76,859,062 effective HSP length: 78 effective length of database: 58,365,574 effective search space used: 1342408202 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -